@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1927: (2016-03-30 )
MPEITVRAKSKTYPVYINEFALEDIREKWTKSLAKFSHVFVLTDGHVAELHKAKLDAVLADLPVVTYYVAPNGEEAKTFRVYEDVMTKMIETGLDRKAVLIAFGGGVIGDLGGFVAATYMRGIPFYQVPTTVLAHDSAVGGKVAINHPLGKNMIGNFYQPEAVIYDTQFFATLPERELRSGFAEMIKHALISDLTLLRALMDTFTEPKDFYTKDLTPFLQRGIEIKANIVAQDETEQGVRAYLNFGHTFGHALEAYGNFGKWLHGEAITYGMIYALTMSETIYGLDFDLAEFKTWLEQLGYDTTFDASVPFSKILENMRHDKKTTFNEISMVLLEEIGKPVIFKADDDLIFETYKRVMRKGGNVI

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_8(1XAG)
AROB_STAAR
[Raw transfer]




NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_B_8(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1XAH)
AROB_STAAR
[Raw transfer]




NAD_A_5(1XAH)
AROB_STAAR
[Raw transfer]




NAD_B_12(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_B_4(3QBD)
AROB_MYCTU
[Raw transfer]




NAD_B_9(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_8(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_A_7(1NVB)
ARO1_EMENI
[Raw transfer]




NAD_A_3(3QBD)
AROB_MYCTU
[Raw transfer]




NAD_A_19(1NRX)
ARO1_EMENI
[Raw transfer]




NAD_B_6(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_B_20(1NRX)
ARO1_EMENI
[Raw transfer]




ADP_A_11(1NVF)
ARO1_EMENI
[Raw transfer]




ADP_B_12(1NVF)
ARO1_EMENI
[Raw transfer]




ADP_B_7(1NVA)
ARO1_EMENI
[Raw transfer]




NAD_A_8(2GRU)
DOIS_BACCI
[Raw transfer]




ADP_C_13(1NVF)
ARO1_EMENI
[Raw transfer]




ADP_A_6(1NVA)
ARO1_EMENI
[Raw transfer]




CRB_A_5(1XAI)
AROB_STAAR
[Raw transfer]




CRB_A_9(1XAG)
AROB_STAAR
[Raw transfer]




CRB_B_6(1XAI)
AROB_STAAR
[Raw transfer]




CRB_B_9(1NVB)
ARO1_EMENI
[Raw transfer]




CRB_B_7(1NVD)
ARO1_EMENI
[Raw transfer]




CRB_A_6(1NVD)
ARO1_EMENI
[Raw transfer]




GOL_A_9(2D2X)
DOIS_BACCI
[Raw transfer]




EXO_A_9(2GRU)
DOIS_BACCI
[Raw transfer]




22 PsiBlast_CBE 91.3638%-114 - C5 -1XAI 4.4 AROB_STAAR
2 PsiBlast_PDB 91.1238%-113 - C5 -1XAG 7.5 AROB_STAAR
1 PsiBlast_PDB 90.5739%-109 - C5 -3OKF 10.0 AROB_VIBCH
45 HHSearch 90.2533%-110 * C5 *3QBE - AROB_MYCTU -
4 PsiBlast_PDB 90.1938%-114 - C5 -1XAI 4.6 AROB_STAAR
40 HHSearch 90.1238%-108 - C5 -3OKF 9.9 AROB_VIBCH
3 PsiBlast_PDB 90.0538%-119 - C5 -1XAH 8.0 AROB_STAAR
21 PsiBlast_CBE 88.8339%-112 - C5 -3OKF 9.7 AROB_VIBCH
41 HHSearch 87.5337%-106 - C5 -1XAH 8.0 AROB_STAAR
44 HHSearch 84.5432%-103 - C5 -1SG6 9.8 ARO1_EMENI
62 Fugue 83.2432% -97 - C5 -1DQS 10.0 ARO1_EMENI
25 PsiBlast_CBE 81.1836% -98 - C5 -3ZOK - DHQS_ACTCH -
24 PsiBlast_CBE 80.9036% -99 - C5 -3ZOK - DHQS_ACTCH -
5 PsiBlast_PDB 80.4236% -97 - C5 -3ZOK - DHQS_ACTCH -
23 PsiBlast_CBE 79.9036%-100 - C5 -3ZOK - DHQS_ACTCH -
26 PsiBlast_CBE 78.7935%-115 - C5 -3QBD 7.7 AROB_MYCTU
39 HHSearch 78.4027% -99 - C5 -2GRU - DOIS_BACCI -
6 PsiBlast_PDB 78.3335%-116 - C5 -3QBD 7.8 AROB_MYCTU
7 PsiBlast_PDB 76.5735%-108 - C5 -3QBE - AROB_MYCTU -
63 Fugue 70.0932% -93 - C5 -1UJN - ? -
27 PsiBlast_CBE 64.1936% -88 - C5 -1SG6 8.4 ARO1_EMENI
17 PsiBlast_PDB 64.0036% -85 - C5 -1SG6 8.7 ARO1_EMENI
36 PsiBlast_CBE 63.1736% -87 - C5 -1NRX 6.0 ARO1_EMENI
10 PsiBlast_PDB 62.3736% -89 - C5 -1NRX 6.2 ARO1_EMENI
34 PsiBlast_CBE 62.1736% -88 - C5 -1NVA 3.9 ARO1_EMENI
12 PsiBlast_PDB 60.3536% -87 - C5 -1NVA 4.3 ARO1_EMENI
19 PsiBlast_PDB 57.2930% -85 - C5 -2GRU 5.0 DOIS_BACCI
18 PsiBlast_PDB 56.9030% -92 - C5 -2D2X 2.1 DOIS_BACCI
14 PsiBlast_PDB 56.8036% -73 - C5 -1NVD 5.4 ARO1_EMENI
28 PsiBlast_CBE 56.6936% -69 - C5 -1NVF 4.0 ARO1_EMENI
29 PsiBlast_CBE 56.1736% -67 - C5 -1NVF 4.1 ARO1_EMENI
37 PsiBlast_CBE 55.9336% -65 - C5 -1NR5 8.2 ARO1_EMENI
32 PsiBlast_CBE 55.8936% -70 - C5 -1NVD 5.3 ARO1_EMENI
16 PsiBlast_PDB 55.8936% -68 - C5 -1NVF 4.0 ARO1_EMENI
9 PsiBlast_PDB 54.7136% -67 - C5 -1NR5 9.0 ARO1_EMENI
38 PsiBlast_CBE 53.9736% -67 - C5 -1DQS 9.2 ARO1_EMENI
8 PsiBlast_PDB 53.9136% -67 - C5 -1DQS 9.0 ARO1_EMENI
33 PsiBlast_CBE 53.2236% -65 - C5 -1NVB 4.7 ARO1_EMENI
13 PsiBlast_PDB 52.3536% -64 - C5 -1NVB 6.8 ARO1_EMENI