@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1929: (2016-03-30 )
MEQTYVMVKPDGVERGLIGEIVTRIEKKGLKIVAGKLMQIDRELAEKHYAEHIGKSFFEDLIGFITSGPVFAMVLEGDDAIATARRMMGKTNPLEADPGTIRADYAIHTNRNVIHGSDSPESAQREIQLFFAPDEILSYQKAVDTWI

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




GTP_B_5(3Q86)
NDK_STAAC
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




ADP_E_14(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_A_8(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




UDP_D_13(3Q8V)
NDK_STAAC
[Raw transfer]




DGT_H_8(1S59)
NDK2_ARATH
[Raw transfer]




GTP_A_3(3Q86)
NDK_STAAC
[Raw transfer]




3AN_B_9(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_B_10(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_C_12(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_A_9(2DYA)
NDK_PYRHO
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




CDP_B_10(3Q89)
NDK_STAAC
[Raw transfer]




3AN_A_7(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_D_12(3Q8U)
NDK_STAAC
[Raw transfer]




CDP_E_12(3Q89)
NDK_STAAC
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




TYD_A_3(1NDC)
NDKC_DICDI
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_B_9(3Q8U)
NDK_STAAC
[Raw transfer]




TBD_C_9(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2DY9)
NDK_PYRHO
[Raw transfer]




ADP_B_5(1NDP)
NDKC_DICDI
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




GDP_A_8(2DXE)
NDK_PYRHO
[Raw transfer]




UDP_B_11(3Q8V)
NDK_STAAC
[Raw transfer]




3AN_C_11(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_B_10(2DYA)
NDK_PYRHO
[Raw transfer]




ADP_H_24(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_D_15(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_C_11(3Q8U)
NDK_STAAC
[Raw transfer]




SON_H_8(1S5Z)
NDKC_DICDI
[Raw transfer]




UDP_A_9(3Q8V)
NDK_STAAC
[Raw transfer]




ADP_F_16(3Q8U)
NDK_STAAC
[Raw transfer]




TBD_A_7(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_E_18(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_G_22(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_A_9(3Q8Y)
NDK_STAAC
[Raw transfer]




TYD_A_3(3EVO)
NDK_MIMIV
[Raw transfer]




DGI_G_7(1S59)
NDK2_ARATH
[Raw transfer]




TBD_B_8(1F6T)
NDKC_DICDI
[Raw transfer]




GNP_A_7(2DXF)
NDK_PYRHO
[Raw transfer]




ANP_A_5(2DXD)
NDK_PYRHO
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




ADP_B_11(3Q8Y)
NDK_STAAC
[Raw transfer]




ANP_B_6(2DXD)
NDK_PYRHO
[Raw transfer]




7 PsiBlast_PDB 95.1463%-107 - C9 -3VVT - ? -
22 PsiBlast_CBE 95.1259%-101 - C9 -3Q8Y 6.4 NDK_STAAC
23 PsiBlast_CBE 94.6659%-103 - C9 -3Q8Y - NDK_STAAC -
28 PsiBlast_CBE 94.4859%-100 - C9 -3Q8V 4.7 NDK_STAAC
26 PsiBlast_CBE 94.2459%-101 - C9 -3Q8Y - NDK_STAAC -
132 HHSearch 94.1758% -99 - C9 -2DXE 7.1 NDK_PYRHO
1 PsiBlast_PDB 94.1659%-100 - C9 -3Q83 - NDK_STAAC -
37 PsiBlast_CBE 93.9859% -97 - C9 -3Q86 6.7 NDK_STAAC
126 HHSearch 93.9260% -97 - C9 -3Q8U 6.8 NDK_STAAC
76 PsiBlast_CBE 93.8857% -99 - C9 -2DY9 6.2 NDK_PYRHO
78 PsiBlast_CBE 93.7657%-100 - C9 -2DXF 4.5 NDK_PYRHO
25 PsiBlast_CBE 93.6559%-100 - C9 -3Q8Y 4.9 NDK_STAAC
80 PsiBlast_CBE 93.6357% -98 - C9 -2DXE 5.9 NDK_PYRHO
77 PsiBlast_CBE 93.6257%-100 - C9 -2DXF - NDK_PYRHO -
82 PsiBlast_CBE 93.6157%-101 - C9 -2DXD 4.5 NDK_PYRHO
15 PsiBlast_PDB 93.6162%-109 - C9 -1WKL 5.6 NDK_THET8
74 PsiBlast_CBE 93.5557% -97 - C9 -2DYA 6.6 NDK_PYRHO
4 PsiBlast_PDB 93.5559% -97 - C9 -3Q8U 6.8 NDK_STAAC
14 PsiBlast_PDB 93.5162%-103 - C9 -1WKK 4.9 NDK_THET8
81 PsiBlast_CBE 93.4657% -99 - C9 -2DXD 4.9 NDK_PYRHO
6 PsiBlast_PDB 93.3759%-101 - C9 -3Q8Y 5.0 NDK_STAAC
29 PsiBlast_CBE 93.2959% -97 - C9 -3Q8V 5.3 NDK_STAAC
35 PsiBlast_CBE 93.2159% -98 - C9 -3Q89 4.5 NDK_STAAC
2 PsiBlast_PDB 93.1459% -97 - C9 -3Q86 5.7 NDK_STAAC
21 PsiBlast_CBE 93.1359%-102 - C9 -3Q8Y 4.3 NDK_STAAC
24 PsiBlast_CBE 93.0759%-101 - C9 -3Q8Y 5.8 NDK_STAAC
5 PsiBlast_PDB 93.0059% -97 - C9 -3Q8V 5.3 NDK_STAAC
32 PsiBlast_CBE 92.9959% -98 - C9 -3Q8U 6.5 NDK_STAAC
45 PsiBlast_CBE 92.9862%-108 - C9 -1WKL 6.0 NDK_THET8
31 PsiBlast_CBE 92.9859%-101 - C9 -3Q8U 6.0 NDK_STAAC
36 PsiBlast_CBE 92.7359% -96 - C9 -3Q89 5.3 NDK_STAAC
34 PsiBlast_CBE 92.7359% -95 - C9 -3Q8U 6.4 NDK_STAAC
30 PsiBlast_CBE 92.6959% -96 - C9 -3Q8U 6.1 NDK_STAAC
73 PsiBlast_CBE 92.6557% -98 - C9 -2DYA 5.6 NDK_PYRHO
27 PsiBlast_CBE 92.5359%-101 - C9 -3Q8Y 4.7 NDK_STAAC
33 PsiBlast_CBE 92.0659% -95 - C9 -3Q8U 6.2 NDK_STAAC
98 PsiBlast_CBE 90.0755% -97 - C9 -1HIY 4.9 NDKC_DICDI
85 PsiBlast_CBE 89.9755% -99 - C9 -2BEF 7.1 NDKC_DICDI
94 PsiBlast_CBE 89.5855% -96 - C9 -1KDN 6.8 NDKC_DICDI
95 PsiBlast_CBE 89.5455% -96 - C9 -1KDN 6.7 NDKC_DICDI
100 PsiBlast_CBE 89.1955% -94 - C9 -1F6T 6.3 NDKC_DICDI
96 PsiBlast_CBE 88.9955% -95 - C9 -1KDN 7.3 NDKC_DICDI
87 PsiBlast_CBE 88.9755% -96 - C9 -2BEF 7.1 NDKC_DICDI
90 PsiBlast_CBE 88.7455% -99 - C9 -1S5Z 5.7 NDKC_DICDI
91 PsiBlast_CBE 88.6955%-100 - C9 -1NDP 7.4 NDKC_DICDI
86 PsiBlast_CBE 88.5455% -97 - C9 -2BEF 6.5 NDKC_DICDI
93 PsiBlast_CBE 88.5255% -97 - C9 -1NDC 6.7 NDKC_DICDI
38 PsiBlast_CBE 88.4653% -97 - C9 -1S59 5.4 NDK2_ARATH
97 PsiBlast_CBE 88.3255%-102 - C9 -1HIY 5.4 NDKC_DICDI
99 PsiBlast_CBE 88.0855% -94 - C9 -1HIY 5.6 NDKC_DICDI
92 PsiBlast_CBE 88.0055% -91 - C9 -1NDP 6.9 NDKC_DICDI
102 PsiBlast_CBE 87.4955% -94 - C9 -1F6T 7.0 NDKC_DICDI
103 Fugue 87.4153% -89 - C9 -1NDP 6.9 NDKC_DICDI
101 PsiBlast_CBE 87.2255% -92 - C9 -1F6T 6.8 NDKC_DICDI
11 PsiBlast_PDB 86.9753% -96 - C9 -1S59 5.7 NDK2_ARATH
127 HHSearch 86.0450% -94 - C9 -1ZS6 6.5 NDK3_HUMAN
133 HHSearch 82.7147% -97 - C9 -3EVO 4.9 NDK_MIMIV
129 HHSearch 82.3949% -92 - C9 -1NHK 5.4 NDK_MYXXA