@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1934: (2016-03-30 )
MANKTDLVNSVAELADLSKKDAAKAVEAVFETIQTSLSKGEKVQLIGFGNFEVRERAARKGRNPRTKEEIDIPASKVPAFKPGKALKEAVK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_H_4(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(2HT0)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(2IIE)

[Raw transfer]

-

NACID_D_2(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(1OWG)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(1OUZ)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(2IIF)
IHFA_ECOLI
[Raw transfer]

-

NACID_C_3(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

1 PsiBlast_PDB 81.5582% -53 - C9 -4QJN - DBH_STAAM -
2 PsiBlast_PDB 80.9382% -44 - C9 -4QJU 6.3 DBH_STAAM
21 PsiBlast_CBE 77.8082% -35 - C9 -4QJU 7.0 DBH_STAAM
3 PsiBlast_PDB 74.8877% -40 - C9 -1HUE - DBH_GEOSE -
4 PsiBlast_PDB 73.8677% -55 - C9 -1HUU - DBH_GEOSE -
38 Fugue 72.7474% -54 - C9 -1HUU - DBH_GEOSE -
5 PsiBlast_PDB 70.2565% -40 - C9 -3RHI - ? -
26 PsiBlast_CBE 67.2453% -27 - C9 -1P51 5.6 DBH_NOSS1
25 PsiBlast_CBE 66.6453% -26 - C9 -1P51 4.2 DBH_NOSS1
27 PsiBlast_CBE 66.3753% -24 - C9 -1P51 3.9 DBH_NOSS1
8 PsiBlast_PDB 65.7453% -24 - C9 -1P51 3.6 DBH_NOSS1
51 HHSearch 65.5854% -52 - C9 -1MUL - DBHA_ECOLI -
10 PsiBlast_PDB 65.5453% -25 - C9 -1P78 5.1 DBH_NOSS1
48 HHSearch 65.3952% -24 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
7 PsiBlast_PDB 65.0555% -52 - C9 -1MUL - DBHA_ECOLI -
53 HHSearch 64.5843% -33 - C9 -1OWF 3.0 IHFA_ECOLI
49 HHSearch 64.5757% -57 - C9 -1B8Z - DBH_THEMA -
9 PsiBlast_PDB 64.2653% -25 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
11 PsiBlast_PDB 63.8157% -58 - C9 -1B8Z - DBH_THEMA -
24 PsiBlast_CBE 63.5853% -28 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
55 HHSearch 63.5443% -31 - C9 -2IIE 2.8 IHFA_ECOLI (first)
23 PsiBlast_CBE 63.0753% -30 - C9 -1P78 4.6 DBH_NOSS1
50 HHSearch 62.2433% -38 - C9 -1OWF 3.4 IHFB_ECOLI
16 PsiBlast_PDB 59.8451% -24 - C9 -2HT0 4.3 IHFA_ECOLI
17 PsiBlast_PDB 56.8950% -9 - C9 -2IIF 6.7 IHFA_ECOLI (first)
18 PsiBlast_PDB 56.4950% -18 - C9 -2IIE 6.3 IHFA_ECOLI (first)
15 PsiBlast_PDB 56.3251% -21 - C9 -1OWG 1128214396763122245304320.0 IHFA_ECOLI
14 PsiBlast_PDB 56.0151% -20 - C9 -1OWF 6.6 IHFA_ECOLI
13 PsiBlast_PDB 55.9251% -25 - C9 -1OUZ 1128214396763122245304320.0 IHFA_ECOLI
56 HHSearch 27.1737% 45 - C9 -2IIE 3.5