@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1984: (2016-03-30 )
VIDTTKTNEKATKKQNKSGAELLIDALKKQQVDMIFGYPGGAVLPLYDAFYDCDIPHILTRHEQGAIHAAEGYARVTGKPGVVVVTSGPGATNVLTGIADAMSDSIPLVIFTGQVHTPGIGKDAFQEADMIGLTIPITKYNYQVRDVRDLPKIVNEAFHIASTGRKGPVVVDIPKDMGIIQTESVRPDTIDLPGYQPTYSPNPLQLEKLMQSLSAASKPLILAGAGVNHARATAELLEFAERYQIPIVNTLLGLGSFPQSHDLFLGMGGMHGSYAANMALTDCDLLINFGSRFDDRLASAPKEFATKATIAHIDIDPAEIGKIIETQIPIVADINETLTQLLQMELPVHPDTSHWYKLNMTRKNRHPFNFDRTKKAEIKPQRVIELIGEITQGEALVSTDVGQHQMWAAQFYPFQFDHQIITSGGLGTMGFGFPAAVGAQLAFPDKTVVAIVGDGGFQMTNQELAILNDYQINVKTVIINNGSLGMVRQWQEKFHGERYSHSIFTSQPDFVKLSEAYGVKGVRLTNPETLEKDLRKAFAHPGPIVIDVHVAKDELVLPMVPSGKPNHQMEGVE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_9(1T9C)
ILVB_YEAST
[Raw transfer]




FAD_B_14(1T9A)
ILVB_YEAST
[Raw transfer]




FAD_B_14(1N0H)
ILVB_YEAST
[Raw transfer]




FAD_A_9(1T9B)
ILVB_YEAST
[Raw transfer]




FAD_A_9(1T9B)
ILVB_YEAST
[Raw transfer]




FAD_B_12(1T9B)
ILVB_YEAST
[Raw transfer]




FAD_A_10(1T9A)
ILVB_YEAST
[Raw transfer]




FAD_B_11(1T9C)
ILVB_YEAST
[Raw transfer]




FAD_A_10(1N0H)
ILVB_YEAST
[Raw transfer]




1CS_A_7(1T9B)
ILVB_YEAST
[Raw transfer]




1TB_A_7(1T9A)
ILVB_YEAST
[Raw transfer]




1CS_B_11(1T9B)
ILVB_YEAST
[Raw transfer]




1TB_B_11(1T9A)
ILVB_YEAST
[Raw transfer]




1SM_A_7(1T9C)
ILVB_YEAST
[Raw transfer]




1SM_B_10(1T9C)
ILVB_YEAST
[Raw transfer]




CIE_B_11(1N0H)
ILVB_YEAST
[Raw transfer]




CIE_A_7(1N0H)
ILVB_YEAST
[Raw transfer]




AYD_A_9(1N0H)
ILVB_YEAST
[Raw transfer]




TPP_A_10(1JSC)
ILVB_YEAST
[Raw transfer]




27 PsiBlast_CBE 98.7344% -93 - C4 -1N0H 12.5 ILVB_YEAST
25 PsiBlast_CBE 98.7344% -93 - C4 -1T9B 11.2 ILVB_YEAST
5 PsiBlast_PDB 98.3144% -93 - C4 -1T9C 12.8 ILVB_YEAST
3 PsiBlast_PDB 98.1544% -91 - C4 -1T9A 12.9 ILVB_YEAST
26 PsiBlast_CBE 97.9044% -93 - C4 -1T9A 13.0 ILVB_YEAST
24 PsiBlast_CBE 97.8744% -95 - C4 -1T9C 13.1 ILVB_YEAST
21 PsiBlast_CBE 97.8544% -93 - C4 -1T9D - ILVB_YEAST -
6 PsiBlast_PDB 97.4144% -93 - C4 -1T9D - ILVB_YEAST -
2 PsiBlast_PDB 97.1744% -93 - C4 -1N0H 12.8 ILVB_YEAST
29 HHSearch 97.0043% -87 - C4 -1T9B 13.1 ILVB_YEAST
23 PsiBlast_CBE 96.4044% -96 - C4 -1T9D - ILVB_YEAST -
4 PsiBlast_PDB 95.9744% -96 - C4 -1T9B 12.8 ILVB_YEAST
22 PsiBlast_CBE 95.5044% -93 - C4 -1T9D - ILVB_YEAST -
1 PsiBlast_PDB 94.5744% -97 - C4 -1JSC 6.3 ILVB_YEAST
30 HHSearch 90.3833% -84 * C4 *2PAN - GCL_ECOLI -
7 PsiBlast_PDB 90.3033% -92 - C4 -2PAN - GCL_ECOLI -
13 PsiBlast_PDB 88.7129% -86 - C4 -4FEG - ? -
15 PsiBlast_PDB 88.6829% -84 - C4 -2EZ4 - POXB_LACPL -
16 PsiBlast_PDB 88.5829% -86 - C4 -2EZ8 - POXB_LACPL -
19 PsiBlast_PDB 88.4429% -85 - C4 -2EZU - POXB_LACPL -