Study : Lmo2032 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: CIT_A_3(1RQ2) / Model_64(1RQ2/A) = [3.2] Download1129.494.32MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
Complex: CIT_A_2(2VXY) / Model_2(2VXY/A) = [3.3] Download747.726.50MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
Complex: CIT_A_2(2VXY) / Model_62(2VXY/A) = [3.3] Download725.926.50MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
Complex: CIT_A_3(2Q1X) / Model_19(2Q1X/A) = [4.0] Download1057.4510.33MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
Complex: GDP_A_2(2VAW) / Model_40(2VAW/A) = [4.8] Download1105.0114.33MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG
Consensus
[pKd Mean = 3.72]
-953
(s=178)
8
(s=3)
MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG