@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2032: (2016-03-31 )
MLEFDTSSESLATIKVIGVGGGGNNAVNRMIEHGVQGVEFISVNTDAQALNLAKAETKLQIGTKLTRGLGAGAVPEIGKKAAEESREQIEEALKGSDMVFVTAGMGGGTGTGAAPVIAQIAKEMGALTVGVVTRPFGFEGPKRTKQALTGTEAMKEAVDTLIVIPNDRLLQIVDKNTPMLEAFREADNVLRQGVQGISDLIAVPGLINLDFADVKTIMTNRGSALMGIGIATGENRAAEAAKKAISSPLLETSVDGAKGVLMNITGGSNLSLYEVQEAAEIVSSASDEDVNMIFGSVINDELKDELIVTVIATGFDEAKQAQQQAQANRRPNQSIQVNRPNYAVQDEQQNDYAQNAPQQANAPVHEQQAEPQQNSSDVDVPAFIRNRNRRG

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_B_5(3WGM)
FTSZ_STAAM
[Raw transfer]




GTP_A_3(3WGM)
FTSZ_STAAM
[Raw transfer]




GSP_A_3(3WGN)
FTSZ_STAAM
[Raw transfer]




GTP_A_3(1W5A)
FTSZ1_METJA
[Raw transfer]




GTP_A_3(1W5B)
FTSZ1_METJA
[Raw transfer]




GSP_B_4(3WGN)
FTSZ_STAAM
[Raw transfer]




G2P_A_3(1W5F)
FTSZ_THEMA
[Raw transfer]




G2P_A_3(1W5F)
FTSZ_THEMA
[Raw transfer]




GTP_B_4(1W5B)
FTSZ1_METJA
[Raw transfer]




GTP_B_5(1W5A)
FTSZ1_METJA
[Raw transfer]




G2P_B_5(1W5F)
FTSZ_THEMA
[Raw transfer]




GDP_A_2(3VOA)
FTSZ_STAAM
[Raw transfer]




GDP_A_4(3VO8)
FTSZ_STAAM
[Raw transfer]




GDP_B_6(3VO8)
FTSZ_STAAM
[Raw transfer]




GDP_A_3(3VOB)
FTSZ_STAAM
[Raw transfer]




GSP_A_3(1RLU)
FTSZ_MYCTU
[Raw transfer]




GDP_A_2(4DXD)
FTSZ_STAAU
[Raw transfer]




GSP_A_3(2Q1Y)
FTSZ_MYCTU
[Raw transfer]




GDP_A_2(4M8I)
FTSZ_STAEQ
[Raw transfer]




GDP_B_4(3WGK)
FTSZ_STAAM
[Raw transfer]




GDP_A_3(3WGK)
FTSZ_STAAM
[Raw transfer]




GDP_A_5(1OFU)
FTSZ_PSEAE
[Raw transfer]




GDP_A_2(2VAW)
FTSZ_PSEAE
[Raw transfer]




GDP_A_3(3WGL)
FTSZ_STAAM
[Raw transfer]




GDP_B_5(4KWE)
FTSZ_MYCTU
[Raw transfer]




GDP_D_4(1FSZ)
FTSZ1_METJA
[Raw transfer]




GDP_C_6(4KWE)
FTSZ_MYCTU
[Raw transfer]




GSP_A_3(2RHO)
FTSZ_BACSU
[Raw transfer]




GDP_B_4(3WGL)
FTSZ_STAAM
[Raw transfer]




GDP_A_2(2VAP)
FTSZ1_METJA
[Raw transfer]




GDP_A_2(2VAP)
FTSZ1_METJA
[Raw transfer]




GDP_A_4(4KWE)
FTSZ_MYCTU
[Raw transfer]




GDP_A_3(2RHL)
FTSZ_BACSU
[Raw transfer]




GDP_A_2(2VAW)
FTSZ_PSEAE
[Raw transfer]




GDP_C_3(1RQ7)
FTSZ_MYCTU
[Raw transfer]




GDP_B_4(2RHO)
FTSZ_BACSU
[Raw transfer]




GDP_B_4(2RHL)
FTSZ_BACSU
[Raw transfer]




GDP_A_5(1OFU)
FTSZ_PSEAE
[Raw transfer]




GDP_B_6(1OFU)
FTSZ_PSEAE
[Raw transfer]




CIT_A_2(2VXY)
FTSZ_BACSU
[Raw transfer]




CIT_A_2(2VXY)
FTSZ_BACSU
[Raw transfer]




CIT_A_3(1RQ2)
FTSZ_MYCTU
[Raw transfer]




CIT_A_3(1RQ2)
FTSZ_MYCTU
[Raw transfer]




GDP_D_4(1FSZ)
?
[Raw transfer]




CIT_A_3(2Q1X)
FTSZ_MYCTU
[Raw transfer]




62 HHSearch 97.4783%-109 - C3 -2VXY 3.3 FTSZ_BACSU
32 PsiBlast_CBE 97.2481%-103 - C3 -3WGJ - FTSZ_STAAM -
14 PsiBlast_PDB 96.9381%-105 - C3 -3WGJ - FTSZ_STAAM -
16 PsiBlast_PDB 96.3481%-103 - C3 -3VOA 7.5 FTSZ_STAAM
17 PsiBlast_PDB 95.8681% -98 - C3 -3VOB 7.0 FTSZ_STAAM
1 PsiBlast_PDB 95.7475%-112 - C3 -2VAM - FTSZ_BACSU -
2 PsiBlast_PDB 95.4975%-109 - C3 -2VXY 3.3 FTSZ_BACSU
15 PsiBlast_PDB 95.4878% -97 - C3 -4M8I 8.5 FTSZ_STAEQ
28 PsiBlast_CBE 93.8269%-101 - C3 -3VO8 6.9 FTSZ_STAAM
10 PsiBlast_PDB 93.7669%-100 - C3 -4DXD 7.6 FTSZ_STAAU
4 PsiBlast_PDB 93.6886%-103 - C3 -2RHH - FTSZ_BACSU -
12 PsiBlast_PDB 93.5469%-102 - C3 -3WGM 9.1 FTSZ_STAAM
5 PsiBlast_PDB 93.4086%-104 - C3 -2RHJ - FTSZ_BACSU -
6 PsiBlast_PDB 93.1686%-107 - C3 -2RHL 5.4 FTSZ_BACSU
8 PsiBlast_PDB 93.1169%-100 - C3 -3VO8 7.2 FTSZ_STAAM
31 PsiBlast_CBE 92.9369%-100 - C3 -3WGK 5.7 FTSZ_STAAM
13 PsiBlast_PDB 92.9269%-103 - C3 -3WGK 6.2 FTSZ_STAAM
30 PsiBlast_CBE 92.8369%-100 - C3 -3WGL 6.0 FTSZ_STAAM
29 PsiBlast_CBE 92.7669%-100 - C3 -3WGM 8.7 FTSZ_STAAM
26 PsiBlast_CBE 92.7586%-100 - C3 -2RHL 5.4 FTSZ_BACSU
9 PsiBlast_PDB 92.6469%-105 - C3 -3WGN 7.1 FTSZ_STAAM
7 PsiBlast_PDB 92.5086%-104 - C3 -2RHO 5.8 FTSZ_BACSU
27 PsiBlast_CBE 92.2369%-104 - C3 -3WGN 6.7 FTSZ_STAAM
11 PsiBlast_PDB 91.9969%-103 - C3 -3WGL 6.0 FTSZ_STAAM
25 PsiBlast_CBE 91.8586%-103 - C3 -2RHO 5.3 FTSZ_BACSU
64 HHSearch 90.2761%-101 - C3 -1RQ2 3.2 FTSZ_MYCTU
35 PsiBlast_CBE 89.5364%-106 - C3 -4KWE 5.6 FTSZ_MYCTU
34 PsiBlast_CBE 88.8664%-109 - C3 -4KWE 5.3 FTSZ_MYCTU
20 PsiBlast_PDB 88.6764%-100 - C3 -2Q1Y 6.7 FTSZ_MYCTU
39 PsiBlast_CBE 88.6564% -99 - C3 -1RLU 6.4 FTSZ_MYCTU
37 PsiBlast_CBE 88.3664%-100 - C3 -1RQ2 2.7 FTSZ_MYCTU
33 PsiBlast_CBE 88.3464%-108 - C3 -4KWE 5.2 FTSZ_MYCTU
36 PsiBlast_CBE 88.0164%-103 - C3 -1RQ7 5.8 FTSZ_MYCTU
19 PsiBlast_PDB 87.0264%-101 - C3 -2Q1X 4.0 FTSZ_MYCTU
63 HHSearch 86.3954% -92 - C3 -2VAW 5.8 FTSZ_PSEAE
65 HHSearch 86.0856% -98 * C3 *1OFU 6.4 FTSZ_PSEAE
67 HHSearch 83.3547% -96 - C3 -2VAP 6.8 FTSZ1_METJA
58 PsiBlast_CBE 82.9948% -93 - C3 -1W5A 6.9 FTSZ1_METJA
42 PsiBlast_CBE 82.8656% -96 - C3 -1OFU 5.2 FTSZ_PSEAE
57 PsiBlast_CBE 82.8348% -96 - C3 -1W5A 6.5 FTSZ1_METJA
41 PsiBlast_CBE 82.8156% -95 - C3 -1OFU 5.4 FTSZ_PSEAE
56 PsiBlast_CBE 82.6148% -99 - C3 -1W5B 7.8 FTSZ1_METJA
55 PsiBlast_CBE 82.6148% -94 - C3 -1W5B 7.2 FTSZ1_METJA
40 PsiBlast_CBE 82.5756% -95 - C3 -2VAW 4.8 FTSZ_PSEAE
54 PsiBlast_CBE 82.5648% -99 - C3 -2VAP 6.8 FTSZ1_METJA
61 PsiBlast_CBE 81.9048% -94 - C3 -1FSZ 6.0 FTSZ1_METJA
43 PsiBlast_CBE 81.1553% -90 - C3 -1W5F 7.7 FTSZ_THEMA
44 PsiBlast_CBE 80.3953% -88 - C3 -1W5F 8.1 FTSZ_THEMA
68 HHSearch 79.3651% -86 - C3 -1W5F 8.1 FTSZ_THEMA
83 Fugue 64.1550% -74 - C3 -1FSZ Error ?