Study : Lmo2076 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 3 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: CHAIN_F_6(2CNM) / Model_26(2CNM/C) = [6.1] Download--VSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQYAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGVVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL
Complex: CHAIN_E_5(2CNM) / Model_27(2CNM/B) = [6.2] Download--VSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQYAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGVVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL
Complex: CHAIN_D_4(2CNM) / Model_1(2CNM/A) = [6.8] Download--VSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQYAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGVVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL
Consensus
[pKd Mean = 6.37]
-0
(s=0)
0
(s=0)
VSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQYAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGVVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL