@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2076: (2016-03-31 )
VSLEEALLFREATVTDLKSIMNVENAAFTVPWTEAAFRNEFIINQYAYYLLAIYKEQVVGYAGVWLVLDEGHITNIAIHPDYQGNHYGEALLREMIRVAKERGVVRMTLEVRVSNDVAQGLYKKLGFQDGAIRKNYYPDTKEDALVMWVDL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_D_13(2CNT)
?
[Raw transfer]




GOL_B_8(2CNT)
?
[Raw transfer]




GOL_A_6(2CNT)
?
[Raw transfer]




GOL_A_6(2CNT)
?
[Raw transfer]




GOL_C_11(2CNT)
?
[Raw transfer]




CHAIN_F_6(2CNM)
?
[Raw transfer]

-

CHAIN_E_5(2CNM)
?
[Raw transfer]

-

CHAIN_D_4(2CNM)
?
[Raw transfer]

-

22 PsiBlast_CBE 93.1438%-119 - C1 -2CNT 2.1 ?
48 HHSearch 93.0336%-134 * C1 *2CNT 2.1 ?
26 PsiBlast_CBE 92.8038%-122 - C1 -2CNM 6.1 ?
21 PsiBlast_CBE 92.3538%-121 - C1 -2CNT 2.2 ?
3 PsiBlast_PDB 92.3138%-118 - C1 -2CNT 2.1 ?
23 PsiBlast_CBE 91.9038%-119 - C1 -2CNT 2.2 ?
24 PsiBlast_CBE 91.8538%-124 - C1 -2CNS - ? -
25 PsiBlast_CBE 91.7438%-118 - C1 -2CNS - ? -
2 PsiBlast_PDB 91.6438%-119 - C1 -2CNS - ? -
27 PsiBlast_CBE 91.3938%-125 - C1 -2CNM 6.2 ?
1 PsiBlast_PDB 91.0538%-121 - C1 -2CNM 6.8 ?
67 HHSearch 82.1323%-135 - C1 -1Z4E - ? -
4 PsiBlast_PDB 79.2027%-117 - C1 -4PV6 - ? -
65 HHSearch 76.9422%-120 - C1 -3DR6 - MDDA_SALTY -
51 HHSearch 76.5520%-113 - C1 -2OB0 - NAA50_HUMAN -
16 PsiBlast_PDB 74.1618%-142 - C1 -3K9U - PAIA_THEAC -
69 Fugue 73.8722%-106 - C1 -3KKW - ? -
6 PsiBlast_PDB 73.5731%-131 - C1 -4LX9 - Y209_SULSO -
9 PsiBlast_PDB 73.4131%-129 - C1 -2X7B - Y209_SULSO -
19 PsiBlast_PDB 73.2918%-136 - C1 -3FIX - PAIA_THEAC -