@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2113: (2016-04-01 )
MNEAVKTLDGWFCLHDFRSIDWAAWRELNPGNQELMLNELSHFLSDMEITKNIGEGEHTIYSILGQKADLVFFTLRDSLEALNEVENRFNKLAIADYLLPTYSYISVVELSNYLASHMAGGDDPYQNKGVRARLYPALPPKKHICFYPMSKKRDGADNWYMLPMEERQQLIRDHGLIGRSYAGKVQQIIGGSIGFDDYEWGVTLFSDDALEFKRIVTEMRFDEASARYAEFGSFFIGNLLLSEQLSKLFTI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




P33_V_11(1T0T)
Y3416_GEOKA
[Raw transfer]




21 PsiBlast_CBE 98.93100%-115 - C6 -4WWS - Y2113_LISMO -
24 PsiBlast_CBE 97.27100%-122 - C6 -4WWS - Y2113_LISMO -
23 PsiBlast_CBE 96.66100%-121 - C6 -4WWS - Y2113_LISMO -
22 PsiBlast_CBE 96.60100%-126 - C6 -4WWS - Y2113_LISMO -
28 PsiBlast_CBE 88.6658%-116 - C6 -1T0T - Y3416_GEOKA -
55 Fugue 88.5059%-118 - C6 -1T0T 4.4 Y3416_GEOKA
25 PsiBlast_CBE 88.2158%-117 - C6 -1T0T - Y3416_GEOKA -
27 PsiBlast_CBE 88.1958%-118 - C6 -1T0T - Y3416_GEOKA -
1 PsiBlast_PDB 88.1958%-118 - C6 -1T0T 4.4 Y3416_GEOKA
33 HHSearch 87.3859%-118 - C6 -1T0T 4.4 Y3416_GEOKA
26 PsiBlast_CBE 87.2658%-114 - C6 -1T0T - Y3416_GEOKA -
2 PsiBlast_PDB 81.9445%-102 - C6 -1VDH - Y1714_THET8 -
34 HHSearch 81.9245%-104 - C6 -1VDH - Y1714_THET8 -
36 HHSearch 64.0217% -80 * C6 *3NN1 - ? -
37 HHSearch 61.2917% -84 - C6 -3DTZ - ? -
56 Fugue 57.4216% -63 - C6 -2VXH - ? -
44 HHSearch 43.1412% -69 - C6 -3NN1 - ? -
61 Fugue 41.1318% -31 - C3 -2OGX - MOSA_AZOVD -
60 Fugue 40.1921% -53 - C5 -3G8Q - CDAT8_METKA -
38 HHSearch 40.0613% -50 - C6 -3QPI - ? -