@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2159: (2016-04-01 )
MKKYQLVIVGYGGMGSYHVTLASAADNLEVHGVFDILEEKREAAAEKGLKIYESFEAVLADEKVDAVLIATPNDSHKELAITALEAGKHVVCEKPVTMTSEDLLAIMDVAKKVNKHFMVHQNRRWDEDFLIIKEIFEQKTIGEMFHLESRVHGANGIPGDWRHLKAHGGGMVLDWGVHLLDQLLFLVDSNVKSVSANLSFALGDEVDDGFVTFITFENGITAQIEVGTTNFIKLPRWYVKGTEGTGIIHDWDLSGEIVQPTALAKTSEPTPIKAGQGLTKTMAPPSEEATNTLSLPAPAKLAPSFYNNFIDVLNNTSEPIVQNEEVYQVLKLIEAIFEAAETNRTIHSI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_B_7(3E18)
?
[Raw transfer]




NAD_A_6(3E18)
?
[Raw transfer]




NAD_A_6(3E18)
?
[Raw transfer]




GOL_A_9(3E18)
?
[Raw transfer]




34 HHSearch 93.8597%-119 - C1 -3E18 11.7 ?
1 PsiBlast_PDB 93.8597%-119 * C1 *3E18 11.7 ?
21 PsiBlast_CBE 93.6697%-128 - C1 -3E18 12.1 ?
46 HHSearch 65.1624% -97 - C1 -3EZY - ? -
53 HHSearch 63.7422% -98 - C1 -3Q2I - ? -
40 HHSearch 62.2921%-104 - C1 -3IP3 - ? -
5 PsiBlast_PDB 61.8623% -85 - C1 -3HNP - ? -
42 HHSearch 61.1422% -89 - C1 -3EUW - ? -
2 PsiBlast_PDB 61.1027% -91 - C1 -3FHL - ? -
41 HHSearch 60.7426% -93 - C1 -3KUX - ? -
39 HHSearch 60.6623% -92 - C1 -3EVN - ? -
7 PsiBlast_PDB 60.4726% -94 - C1 -3GFG - IOLW_BACSU -
6 PsiBlast_PDB 60.3526% -96 - C1 -3GDO - IOLW_BACSU -
51 HHSearch 60.2624% -93 - C1 -3FHL - ? -
18 PsiBlast_PDB 60.0623% -83 - C1 -3FD8 - ? -
20 PsiBlast_PDB 60.0226% -93 - C1 -3Q2I - ? -
35 HHSearch 59.5319% -94 - C1 -3CEA - ? -
38 HHSearch 59.4219% -96 - C1 -3U3X - ? -
54 HHSearch 59.3521% -97 - C1 -3MZ0 - IOLG_BACSU -
37 HHSearch 58.8820% -81 - C1 -3RC1 - ? -