@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2170: (2016-04-01 )
MSLTEMLQIKYPILQGAMAQIATYELASAVSNAGGLGIIASGGMSADALREQIRLCKEKTTKPFAVNIMLMMPNCPELVDVIIEEDVRVVTTGAGTPKPFMEKFKAAGIKVIAVIPSVKIAQKMEEIGVDAVVAEGTEAGGHVGETTTMALVRQVVSAVNIPVIAAGGIADGHGMAAVYALGASGVQIGTLFLVAEECPVPASFKQAVLDATDTSTTVTGRRNGAPVRSIKNPMIQKYVELENENASRDKLEELTLGSLRKAVHEGDVENGSVMAGQICGMLTEIRSTSDIIENLMKESKQVASNLVIQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_9(2Z6J)
?
[Raw transfer]




FMN_A_9(2Z6I)
?
[Raw transfer]




FMN_B_10(4IQL)
?
[Raw transfer]




TUI_B_10(2Z6J)
?
[Raw transfer]




95 HHSearch 96.8750%-117 - C3 -3BO9 - ? -
2 PsiBlast_PDB 95.5148%-117 - C3 -3BO9 - ? -
94 HHSearch 92.8149%-115 - C3 -2Z6I 9.5 ?
3 PsiBlast_PDB 90.2648%-118 - C3 -2Z6I - ? -
21 PsiBlast_CBE 88.8650%-119 - C3 -2Z6J 8.9 ?
1 PsiBlast_PDB 88.5250%-117 * C3 *2Z6J - ? -
22 PsiBlast_CBE 88.2242%-114 - C3 -4IQL 9.1 ?
4 PsiBlast_PDB 87.8842%-113 - C3 -4IQL - ? -
6 PsiBlast_PDB 79.1233%-105 - C3 -2GJN - 2NPD_PSEAE -
5 PsiBlast_PDB 78.0733%-105 - C3 -2GJL - 2NPD_PSEAE -
96 HHSearch 77.8632%-109 - C3 -2GJL - 2NPD_PSEAE -
84 Fugue 77.5631%-110 - C3 -2GJL - 2NPD_PSEAE -
8 PsiBlast_PDB 76.2133%-117 - C3 -4Q4K - ? -
23 PsiBlast_CBE 75.7333%-118 - C3 -4QIS - ? -
26 PsiBlast_CBE 74.9732%-118 - C3 -4QIU - ? -
25 PsiBlast_CBE 74.8932%-120 - C3 -4QIT - ? -
7 PsiBlast_PDB 74.4633%-120 - C3 -4QIS - ? -
10 PsiBlast_PDB 74.3532%-117 - C3 -4QIU - ? -
24 PsiBlast_CBE 74.2133%-116 - C3 -4Q4K - ? -
9 PsiBlast_PDB 73.8232%-116 - C3 -4QIT - ? -