@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2184: (2016-04-01 )
MRKMAVISLVLLLFLVGCGKEEAAQKPEQKTDKEPKIVATTVAITEIMDKLDLPLVGIPSSSKKLPKRYADVKETGSPMGPDLEIIRMLKPDMVLSTKTLEADLKSGFEGADLEADFLDFTSIASMQTEIKNLGAKFDRIEEATKLNKDLTSDIDQVKSNVAKKKKPTVLILMGVPGSYLVVTEHAYIGDLVKLAGGENVIKDQKVEYLASNTEYLQSANPDIILRAAHGMPAEVVKMFDEEFKTNDIWKHFDAVKNNRVYDLDENLFGMTASLNAPEALKEMEKMLYDN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(2Q8P)
ISDE_STAAN
[Raw transfer]




HEM_A_2(2Q8P)
ISDE_STAAN
[Raw transfer]




HEM_A_2(2Q8Q)
ISDE_STAAN
[Raw transfer]




21 HHSearch 99.0453% -94 - C1 -2Q8P 9.4 ISDE_STAAN
1 PsiBlast_PDB 98.6353% -91 - C1 -2Q8Q 9.3 ISDE_STAAN
2 PsiBlast_PDB 97.8351% -94 - C1 -2Q8P 9.4 ISDE_STAAN
23 HHSearch 73.9320% -90 - C1 -2R7A - ? -
22 HHSearch 69.6819% -82 - C1 -2R79 - ? -
25 HHSearch 66.6121% -59 - C1 -3LHS - ? -
45 Fugue 64.6720% -81 - C1 -1N2Z - BTUF_ECOLI -
46 Fugue 64.1718% -62 - C1 -2CHU - ? -
44 Fugue 63.5320% -67 - C1 -1N2Z - BTUF_ECOLI -
33 HHSearch 63.2819% -46 * C1 *3TNY - ? -
24 HHSearch 62.8719% -69 - C1 -3MD9 - HMUT_YERPE -
32 HHSearch 62.8020% -68 - C1 -1N2Z - BTUF_ECOLI -
28 HHSearch 62.7317% -67 - C1 -3PSH - Y1472_HAEIN -
7 PsiBlast_PDB 61.8126% -45 - C1 -3LHS - ? -
6 PsiBlast_PDB 61.8126% -43 - C1 -3EIW - ? -
8 PsiBlast_PDB 61.4026% -46 - C1 -3LI2 - ? -
3 PsiBlast_PDB 60.8522% -78 - C1 -1N4A - BTUF_ECOLI -
35 HHSearch 60.8020% -57 - C1 -3GFV - YCLQ_BACSU -
34 HHSearch 60.6920% -55 - C1 -3MWF - ? -
10 PsiBlast_PDB 60.2527% -43 - C1 -3EIX - ? -