Study : Lmo2192 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: ATP_A_9(1XEF) / Model_91(1XEF/A) = [4.9] Download1004.774.12MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK
Complex: ADP_B_2(2FF7) / Model_75(2FF7/A) = [5.0] Download694.633.00MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK
Complex: ADP_B_2(2FFB) / Model_82(2FFB/A) = [5.1] Download639.613.00MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK
Complex: ADP_B_2(2FFA) / Model_87(2FFA/A) = [5.1] Download503.323.00MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK
Complex: 128_A_2(2PMK) / Model_74(2PMK/A) = [5.3] Download751.084.08MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK
Consensus
[pKd Mean = 5.08]
-718
(s=164)
3
(s=0)
MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK