@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2192: (2016-04-01 )
MTEQREKLLEIHNLKQYFNKGTASEVRAVDDISFDIYKGETLGLVGESGCGKSTTGRTIIRLYDATGGEVIYNGKDVHARKSRKEMLEFRRKMQMIFQDPYASLNPRMKVKDIIAEGIRIHGLAKTPEETNKQVYDLLETVGLSKEHAGRYPHEFSGGQRQRIGIARALAVQPEFIIADEPISALDVSIQAQVVNLLRQLQKEKNLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPANDLYHAPLHPYTESLLSAIPLPDPNYERTRVRKTYDPTSHNYKDGDEIKMREIAPGHFVYCSEEEEVMYKEKHAKLTAEAAAK

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




ADP_B_2(2FFB)

[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




SF4_B_2(4FWI)
?
[Raw transfer]




130 Fugue 90.0127% -81 - C1 -3TUZ - METN_ECOLI -
5 PsiBlast_PDB 89.3930% -96 - C1 -3TUI - METN_ECOLI -
6 PsiBlast_PDB 88.9130% -98 - C1 -3TUZ - METN_ECOLI -
114 HHSearch 87.5930%-104 - C1 -3TUI - METN_ECOLI -
2 PsiBlast_PDB 87.2830%-100 - C1 -3DHW - METN_ECOLI -
132 Fugue 86.1826% -70 - C1 -1OXS - ? -
1 PsiBlast_PDB 85.8935% -92 - C1 -4FWI 2.5 ?
135 Fugue 85.8526% -73 - C1 -1Z47 - ? -
32 PsiBlast_CBE 84.1332% -98 - C1 -2OLK - ? -
14 PsiBlast_PDB 84.0732%-100 - C1 -2OUK - ? -
13 PsiBlast_PDB 83.7632% -97 - C1 -2OLK - ? -
23 PsiBlast_CBE 83.4733% -93 - C1 -4U02 - ? -
12 PsiBlast_PDB 83.4732% -98 - C1 -2OLJ - ? -
4 PsiBlast_PDB 83.3833% -91 - C1 -4U02 - ? -
3 PsiBlast_PDB 83.1433% -92 - C1 -4U00 - ? -
70 PsiBlast_CBE 82.8534% -84 - C1 -3FVQ - FBPC_NEIG1 -
29 PsiBlast_CBE 82.7332% -96 - C1 -2OUK - ? -
33 PsiBlast_CBE 82.4932% -95 - C1 -2OLK - ? -
34 PsiBlast_CBE 82.3632% -96 - C1 -2OLK - ? -
7 PsiBlast_PDB 82.3433% -90 - C1 -2YYZ - ? -
86 PsiBlast_CBE 64.1132% -84 - C1 -2FGJ 5.6 HLYBP_ECOLX
74 PsiBlast_CBE 63.5233% -86 - C1 -2PMK 5.3
83 PsiBlast_CBE 63.4032% -83 - C1 -2FGJ 5.4
85 PsiBlast_CBE 63.1932% -81 - C1 -2FGJ 5.8 HLYBP_ECOLX
89 PsiBlast_CBE 62.9832% -90 - C1 -1XEF 5.5 HLYBP_ECOLX
75 PsiBlast_CBE 62.8433% -83 - C1 -2FF7 5.0
82 PsiBlast_CBE 62.7232% -78 - C1 -2FFB 5.1
91 PsiBlast_CBE 62.6332% -81 - C1 -1XEF 4.9 HLYBP_ECOLX
81 PsiBlast_CBE 62.5432% -81 - C1 -2FGK 6.0 HLYBP_ECOLX
87 PsiBlast_CBE 62.2832% -80 - C1 -2FFA 5.1
80 PsiBlast_CBE 61.9432% -78 - C1 -2FGK 6.1 HLYBP_ECOLX
90 PsiBlast_CBE 61.6932% -84 - C1 -1XEF 5.9 HLYBP_ECOLX
84 PsiBlast_CBE 61.6432% -83 - C1 -2FGJ 5.5 HLYBP_ECOLX
79 PsiBlast_CBE 61.2632% -77 - C1 -2FGK 5.3 HLYBP_ECOLX
88 PsiBlast_CBE 60.7732% -83 - C1 -1XEF 5.8
78 PsiBlast_CBE 60.1432% -80 - C1 -2FGK 6.1
77 PsiBlast_CBE 59.8432% -85 - C1 -3B5J 5.4