@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2202: (2016-04-01 )
MNAGILGVGKYVPEKIVTNFDLEKIMDTSDEWIRTRTGIEERRIARDDEYTHDLAYEAAKVAIKNAGLTPDDIDLFIVATVTQEATFPSVANIIQDRLGAKNAAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGADKLSKITNWDDRTTAVLFGDGAGAVVMGPVSDDHGLLSFDLGSDGSGGKYLNLDENKKIYMNGREVFRFAVRQMGEASLRVLERAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKYGNTSSSSIALALVDAVEEGRIKDNDNVLLVGFGGGLTWGALIIRWGK

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_C_3(1HND)
FABH_ECOLI
[Raw transfer]




DCC_B_4(1U6S)
FABH_MYCTU
[Raw transfer]




COA_A_5(2EFT)
FABH_ECOLI
[Raw transfer]




COA_A_5(2GYO)
FABH_ECOLI
[Raw transfer]




DCC_A_3(1U6S)
FABH_MYCTU
[Raw transfer]




COA_C_3(1MZJ)
FABH_STRLI
[Raw transfer]




COA_C_3(1MZJ)
FABH_STRLI
[Raw transfer]




COA_D_4(1MZJ)
FABH_STRLI
[Raw transfer]




GOL_I_9(1HZP)
FABH_MYCTU
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




UDT_A_3(2QNX)
FABH_MYCTU
[Raw transfer]




B82_C_7(3IL5)
FABH_ENTFA
[Raw transfer]




DAO_C_3(1HZP)
FABH_MYCTU
[Raw transfer]




B82_D_8(3IL5)
FABH_ENTFA
[Raw transfer]




B82_A_5(3IL5)
FABH_ENTFA
[Raw transfer]




COA_A_3(1EBL)
FABH_ECOLI
[Raw transfer]




B82_B_6(3IL5)
FABH_ENTFA
[Raw transfer]




UDT_B_5(2QNX)
FABH_MYCTU
[Raw transfer]




VZZ_B_5(2QO1)
FABH_MYCTU
[Raw transfer]




COA_A_3(2QX1)
FABH_MYCTU
[Raw transfer]




VZZ_A_3(2QO1)
FABH_MYCTU
[Raw transfer]




ACE_F_6(1MZJ)
FABH_STRLI
[Raw transfer]




ACE_E_5(1MZJ)
FABH_STRLI
[Raw transfer]




73 HHSearch 95.3958% -97 - C2 -1ZOW - FABH_STAAW -
1 PsiBlast_PDB 95.2258% -96 - C2 -1ZOW - FABH_STAAW -
2 PsiBlast_PDB 94.5358% -92 - C2 -3IL7 - FABH_STAAR -
10 PsiBlast_PDB 90.7244%-100 - C2 -1HND 8.5 FABH_ECOLI
21 PsiBlast_CBE 90.4648% -98 - C2 -1UB7 - ? -
5 PsiBlast_PDB 90.3645% -99 - C2 -4DFE - ? -
22 PsiBlast_CBE 89.8748% -95 - C2 -1UB7 - ? -
9 PsiBlast_PDB 89.8144% -99 - C2 -1HN9 - FABH_ECOLI -
3 PsiBlast_PDB 89.7649%-101 - C2 -2EBD - FABH_AQUAE -
24 PsiBlast_CBE 89.7044%-100 - C2 -2GYO - FABH_ECOLI -
25 PsiBlast_CBE 89.6344%-100 - C2 -2EFT - FABH_ECOLI -
70 HHSearch 89.6145% -98 * C2 *1HNJ 8.9 FABH_ECOLI
11 PsiBlast_PDB 89.4644% -99 - C2 -1HNJ 8.9 FABH_ECOLI
26 PsiBlast_CBE 89.2544% -98 - C2 -1HN9 - FABH_ECOLI -
14 PsiBlast_PDB 89.1144%-100 - C2 -2GYO 7.7 FABH_ECOLI
61 Fugue 88.9950% -95 - C2 -1UB7 - ? -
13 PsiBlast_PDB 88.9544%-102 - C2 -2EFT 8.2 FABH_ECOLI
4 PsiBlast_PDB 88.7948% -96 - C2 -1UB7 - ? -
80 HHSearch 88.7549% -98 - C2 -2EBD - FABH_AQUAE -
23 PsiBlast_CBE 88.4848% -95 - C2 -1UB7 - ? -
17 PsiBlast_PDB 88.4743% -99 - C2 -1EBL 2.8 FABH_ECOLI
41 PsiBlast_CBE 85.3638%-103 - C2 -2QX1 4.0 FABH_MYCTU
46 PsiBlast_CBE 85.2038%-100 - C2 -2QNX 3.4 FABH_MYCTU
49 PsiBlast_CBE 84.9238%-100 - C2 -1HZP 4.2 FABH_MYCTU
43 PsiBlast_CBE 84.7338%-101 - C2 -2QO1 3.7 FABH_MYCTU
35 PsiBlast_CBE 84.6338% -96 - C2 -3IL5 6.0 FABH_ENTFA
55 PsiBlast_CBE 84.0338% -98 - C2 -1U6S 6.0 FABH_MYCTU
47 PsiBlast_CBE 83.9038% -99 - C2 -2QNX 3.9 FABH_MYCTU
54 PsiBlast_CBE 83.6638% -97 - C2 -1U6S 5.7 FABH_MYCTU
36 PsiBlast_CBE 83.6438% -91 - C2 -3IL5 6.1 FABH_ENTFA
42 PsiBlast_CBE 83.4738% -97 - C2 -2QO1 3.9 FABH_MYCTU
20 PsiBlast_PDB 83.1738% -93 - C2 -3IL5 6.0 FABH_ENTFA
48 PsiBlast_CBE 83.0838%-101 - C2 -1HZP 2.4 FABH_MYCTU
37 PsiBlast_CBE 82.7138% -91 - C2 -3IL5 5.0 FABH_ENTFA
77 HHSearch 79.2538% -89 - C2 -1MZJ 4.1 FABH_STRLI
38 PsiBlast_CBE 75.7638% -90 - C2 -1MZJ 2.8 FABH_STRLI
39 PsiBlast_CBE 75.6538% -85 - C2 -1MZJ 4.1 FABH_STRLI