@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2205: (2016-04-01 )
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRAIKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAAHGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNADLKPVNKYYLDK

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

VO3_A_2(1E59)
GPMA_ECOLI
[Raw transfer]




DG2_A_3(3FDZ)
GPMA_BURP1
[Raw transfer]




DG2_A_4(2H4Z)
PMGE_HUMAN
[Raw transfer]




3PG_A_5(3GP5)
GPMA_BURP1
[Raw transfer]




3PG_B_9(3GP5)
GPMA_BURP1
[Raw transfer]




DG2_B_3(2H4Z)
PMGE_HUMAN
[Raw transfer]




BHC_H_8(1BQ4)
PMG1_YEAST
[Raw transfer]




3PG_B_4(2H52)
PMGE_HUMAN
[Raw transfer]




IHP_J_10(1BQ3)
PMG1_YEAST
[Raw transfer]




3PG_B_4(2A9J)
PMGE_HUMAN
[Raw transfer]




3PG_B_6(2F90)
PMGE_HUMAN
[Raw transfer]




3PG_A_5(2F90)
PMGE_HUMAN
[Raw transfer]




3PG_A_3(2H52)
PMGE_HUMAN
[Raw transfer]




3PG_B_4(2H4X)
PMGE_HUMAN
[Raw transfer]




3PG_A_3(2H4X)
PMGE_HUMAN
[Raw transfer]




3PG_A_3(2A9J)
PMGE_HUMAN
[Raw transfer]




IHP_I_9(1BQ3)
PMG1_YEAST
[Raw transfer]




GOL_B_10(3GW8)
GPMA_BURP1
[Raw transfer]




GOL_A_4(3GW8)
GPMA_BURP1
[Raw transfer]




GOL_A_5(1RII)
GPMA_MYCTU
[Raw transfer]




CIT_B_5(1YFK)
PGAM1_HUMAN
[Raw transfer]




GOL_A_5(1RII)
GPMA_MYCTU
[Raw transfer]




CIT_A_4(1YFK)
PGAM1_HUMAN
[Raw transfer]




GOL_D_7(1RII)
GPMA_MYCTU
[Raw transfer]




GOL_B_6(1RII)
GPMA_MYCTU
[Raw transfer]




3PG_J_10(1QHF)
PMG1_YEAST
[Raw transfer]




3PG_I_9(1QHF)
PMG1_YEAST
[Raw transfer]




3PG_I_9(1QHF)
PMG1_YEAST
[Raw transfer]




3PG_I_9(1QHF)
PMG1_YEAST
[Raw transfer]




EDO_A_5(4EMB)
GPMA_BORBU
[Raw transfer]




113 HHSearch 98.5061% 0 - C- -3GP3 - GPMA_BURP1 -
7 PsiBlast_PDB 97.5361% 0 - C- -3GP3 - GPMA_BURP1 -
21 PsiBlast_CBE 93.9860% -77 - C1 -4ODI - ? -
5 PsiBlast_PDB 93.8661% -84 - C1 -3EZN - GPMA_BURP1 -
3 PsiBlast_PDB 93.7760% -76 - C1 -4ODI - ? -
112 HHSearch 93.6056% -84 - C1 -3KKK - ? -
11 PsiBlast_PDB 93.5756% -86 - C1 -3KKK - ? -
9 PsiBlast_PDB 93.5461% -82 - C1 -3GW8 3.8 GPMA_BURP1
2 PsiBlast_PDB 93.2858% -79 - C1 -4EMB 3.6 GPMA_BORBU
26 PsiBlast_CBE 92.7061% -80 - C1 -3GP5 4.8 GPMA_BURP1
46 PsiBlast_CBE 92.3456% -76 - C1 -4GPI - PGAM1_HUMAN -
23 PsiBlast_CBE 92.3460% -76 - C1 -4ODI - ? -
22 PsiBlast_CBE 92.2560% -75 - C1 -4ODI - ? -
31 PsiBlast_CBE 92.0456% -83 - C1 -1XQ9 - ? -
24 PsiBlast_CBE 92.0361% -79 - C1 -3LNT - GPMA_BURP1 -
30 PsiBlast_CBE 91.9061% -82 - C1 -3EZN - GPMA_BURP1 -
8 PsiBlast_PDB 91.6861% -79 - C1 -3GP5 4.4 GPMA_BURP1
4 PsiBlast_PDB 91.6461% -80 - C1 -3LNT - GPMA_BURP1 -
6 PsiBlast_PDB 91.5061% -79 - C1 -3FDZ 5.5 GPMA_BURP1
25 PsiBlast_CBE 91.4661% -81 - C1 -3GW8 2.6 GPMA_BURP1
18 PsiBlast_PDB 91.2756% -73 - C1 -1YFK 3.2 PGAM1_HUMAN
58 PsiBlast_CBE 90.2256% -74 - C1 -1YFK 2.3 PGAM1_HUMAN
1 PsiBlast_PDB 89.9961% -73 - C1 -1E59 5.4 GPMA_ECOLI
17 PsiBlast_PDB 87.7553% -73 - C1 -1QHF 3.3 PMG1_YEAST
14 PsiBlast_PDB 87.6653% -74 - C1 -1BQ3 2.8 PMG1_YEAST
45 PsiBlast_CBE 87.5953% -70 - C1 -1QHF 2.7 PMG1_YEAST
114 HHSearch 86.9852% -74 - C1 -1QHF 3.3 PMG1_YEAST
44 PsiBlast_CBE 86.1853% -71 - C1 -1BQ3 3.4 PMG1_YEAST
41 PsiBlast_CBE 85.8353% -75 - C1 -1BQ4 4.4 PMG1_YEAST
136 Fugue 85.7551% -72 - C1 -1QHF 3.3 PMG1_YEAST
118 HHSearch 85.2651% -72 - C1 -1RII 2.4 GPMA_MYCTU
75 PsiBlast_CBE 84.7650% -70 - C1 -1RII 2.4 GPMA_MYCTU
66 PsiBlast_CBE 84.3450% -76 - C1 -2H4X 3.9 PMGE_HUMAN
63 PsiBlast_CBE 84.3350% -75 - C1 -2H4Z 5.7 PMGE_HUMAN
65 PsiBlast_CBE 84.2850% -77 - C1 -2H4X 4.0 PMGE_HUMAN
64 PsiBlast_CBE 84.0250% -77 - C1 -2H4Z 5.3 PMGE_HUMAN
67 PsiBlast_CBE 83.6050% -77 - C1 -2F90 4.0 PMGE_HUMAN
72 PsiBlast_CBE 83.5250% -66 - C1 -1RII 2.4 GPMA_MYCTU
62 PsiBlast_CBE 83.3950% -75 - C1 -2H52 4.2 PMGE_HUMAN
70 PsiBlast_CBE 83.3050% -76 - C1 -2A9J 4.2 PMGE_HUMAN
61 PsiBlast_CBE 83.3050% -75 - C1 -2H52 3.9 PMGE_HUMAN
74 PsiBlast_CBE 83.2250% -67 * C1 *1RII 2.2 GPMA_MYCTU
69 PsiBlast_CBE 82.4350% -73 - C1 -2A9J 4.1 PMGE_HUMAN
68 PsiBlast_CBE 82.3650% -75 - C1 -2F90 5.3 PMGE_HUMAN