@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2236: (2016-04-02 )
MENRISGTTRLLGLIGTPIDHSKSPIMYNYSFQKAGLDYAYLAFDTPIQKVADTIKAIKTFNLRGANVTMPCKSEVLKHMDDLSPAARMIGAVNTIVNEDGKLTGHITDGLGFIANLRDASVDVAGKKMTIIGAGGAATAIQVQCALDGAKEITIFNIKDAFYDKAKQTVASIKQEVPNCIVHIYDLNDTEKLNAEITTSDILVNATLVGMHPNEHETPISDTSVFRKELIVADIIYNPKKTQLLLDAEAAGCKTVGGLGMLLWQGAEAYKLFTGKDMPVSEVKDLYFN

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_C_9(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_D_11(2HK9)
AROE_AQUAE
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




NAP_A_6(2O7S)
DHQSD_ARATH
[Raw transfer]




NAP_A_6(2O7S)
DHQSD_ARATH
[Raw transfer]




NAP_B_7(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_B_6(1NVT)
AROE_METJA
[Raw transfer]




NAD_B_8(3TNL)
AROE_LISMO
[Raw transfer]




NAP_B_21(1NYT)
AROE_ECOLI
[Raw transfer]




NAD_D_13(3TNL)
AROE_LISMO
[Raw transfer]




NAD_C_10(3TNL)
AROE_LISMO
[Raw transfer]




NAD_A_3(1NPD)
YDIB_ECOLI
[Raw transfer]




NAP_D_23(1NYT)
AROE_ECOLI
[Raw transfer]




NAP_A_19(1NYT)
AROE_ECOLI
[Raw transfer]




NAP_C_22(1NYT)
AROE_ECOLI
[Raw transfer]




SKM_A_2(3PHH)
AROE_HELPY
[Raw transfer]




NAD_B_5(3T4E)
YDIB_SALTY
[Raw transfer]




DHK_A_6(2O7Q)
DHQSD_ARATH
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




SKM_E_5(2GPT)
DHQSD_ARATH
[Raw transfer]




SKM_A_5(2EV9)
AROE_THET8
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




NAD_A_3(3T4E)
YDIB_SALTY
[Raw transfer]




NAD_A_3(3T4E)
YDIB_SALTY
[Raw transfer]




SKM_A_2(3DOO)
AROE_STAEQ
[Raw transfer]




DHK_A_5(2O7S)
DHQSD_ARATH
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




ATR_A_5(2HK9)
AROE_AQUAE
[Raw transfer]




ATR_A_5(2HK9)
AROE_AQUAE
[Raw transfer]




NAD_A_5(1VI2)
YDIB_ECOLI
[Raw transfer]




NAD_A_3(1O9B)
YDIB_ECOLI
[Raw transfer]




DTV_A_20(1NYT)
AROE_ECOLI
[Raw transfer]




DTV_A_20(1NYT)
AROE_ECOLI
[Raw transfer]




25 PsiBlast_CBE 99.5053%-110 - C7 -3TOZ - AROE_LISMO -
28 PsiBlast_CBE 99.2953%-108 - C7 -3TNL 8.5 AROE_LISMO
26 PsiBlast_CBE 99.2953%-110 - C7 -3TOZ - AROE_LISMO -
24 PsiBlast_CBE 99.2353%-110 - C7 -3TOZ - AROE_LISMO -
27 PsiBlast_CBE 99.1353%-110 - C7 -3TOZ - AROE_LISMO -
1 PsiBlast_PDB 98.7953%-108 - C7 -3TOZ - AROE_LISMO -
21 PsiBlast_CBE 98.7353%-108 - C7 -3TOZ - AROE_LISMO -
2 PsiBlast_PDB 98.7353%-109 - C7 -3TNL 6.8 AROE_LISMO
29 PsiBlast_CBE 98.6853%-107 - C7 -3TNL 7.3 AROE_LISMO
22 PsiBlast_CBE 98.6253%-108 - C7 -3TOZ - AROE_LISMO -
23 PsiBlast_CBE 98.5553%-107 - C7 -3TOZ - AROE_LISMO -
30 PsiBlast_CBE 98.3353%-105 - C7 -3TNL 8.2 AROE_LISMO
58 HHSearch 97.9153%-105 - C7 -3TNL 6.8 AROE_LISMO
3 PsiBlast_PDB 90.4941%-112 - C7 -1VI2 8.0 YDIB_ECOLI
4 PsiBlast_PDB 89.6141%-102 - C7 -1NPD 9.5 YDIB_ECOLI
57 HHSearch 89.3544%-103 - C7 -3T4E 9.0 YDIB_SALTY
31 PsiBlast_CBE 89.1646%-100 - C7 -3T4E 9.0 YDIB_SALTY
5 PsiBlast_PDB 88.7641%-107 - C7 -1O9B 7.7 YDIB_ECOLI
6 PsiBlast_PDB 88.5446%-100 - C7 -3T4E 9.0 YDIB_SALTY
8 PsiBlast_PDB 85.2234%-107 - C7 -2HK7 - AROE_AQUAE -
35 PsiBlast_CBE 84.5534%-101 - C7 -2HK9 6.8 AROE_AQUAE
10 PsiBlast_PDB 84.2934%-102 - C7 -2HK9 5.6 AROE_AQUAE
34 PsiBlast_CBE 83.7134% -99 - C7 -2HK9 6.9 AROE_AQUAE
33 PsiBlast_CBE 83.3834% -94 - C7 -2HK9 7.8 AROE_AQUAE
72 HHSearch 82.3134% -98 - C7 -2HK9 5.5 AROE_AQUAE
61 HHSearch 81.5238% -95 - C7 -1NVT 7.4 AROE_METJA
32 PsiBlast_CBE 79.1539% -97 - C7 -1NVT 6.5 AROE_METJA
69 HHSearch 79.0934% -83 - C7 -2O7S 6.9 DHQSD_ARATH
7 PsiBlast_PDB 78.5239%-100 - C7 -1NVT 5.7 AROE_METJA
60 HHSearch 77.5532% -95 * C7 *2D5C 3.8 AROE_THET8
37 PsiBlast_CBE 77.1432% -79 - C7 -2GPT 3.7 DHQSD_ARATH
20 PsiBlast_PDB 76.4432% -80 - C7 -2O7S 5.4 DHQSD_ARATH
67 HHSearch 76.4130% -86 - C7 -1NYT 2.1 AROE_ECOLI
19 PsiBlast_PDB 75.0332% -77 - C7 -2O7Q 3.8 DHQSD_ARATH
13 PsiBlast_PDB 71.1530% -88 - C7 -3DOO 2.7 AROE_STAEQ
17 PsiBlast_PDB 70.9330% -91 - C7 -2EV9 3.9 AROE_THET8
16 PsiBlast_PDB 70.5130% -90 - C7 -2D5C 3.7 AROE_THET8
38 PsiBlast_CBE 69.4231% -72 - C7 -1NYT 5.0 AROE_ECOLI
39 PsiBlast_CBE 68.9931% -73 - C7 -1NYT 6.2 AROE_ECOLI
40 PsiBlast_CBE 68.4331% -69 - C7 -1NYT 6.3 AROE_ECOLI
41 PsiBlast_CBE 68.0231% -69 - C7 -1NYT 6.3 AROE_ECOLI