@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2376: (2016-04-03 )
MTYPQLSKEVAPNEIEAEMITNRGTIRIKLFPEIAPKTVENFVTHSKNGYYDGLIFHRVIPEFMIQGGDPDGRGTGGESIWGESFEDEFSTEAFNLRGALSMANAGPNTNGSQFFIVQKPDMPADMLGQMEQAGFPVEVIEAYKQGGTPWLDGRHTVFGHVIEGMDVVDEIANLPTGMQDKPVNDVVIEKINIK

Atome Classification :

(98 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

WM1_A_4(4N1P)
?
[Raw transfer]




CHAIN_V_6(2POY)
?
[Raw transfer]

-

EA4_A_2(4ZSC)
?
[Raw transfer]




67Z_X_2(4J5A)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(3RDC)
PPIF_HUMAN
[Raw transfer]




7B7_X_2(4J5E)
PPIF_HUMAN
[Raw transfer]




6B4_A_2(4J5B)
PPIF_HUMAN
[Raw transfer]




EA4_A_2(4XNC)
?
[Raw transfer]




EA4_A_2(3RDD)
PPIA_HUMAN
[Raw transfer]




671_A_2(4J59)
PPIF_HUMAN
[Raw transfer]




728_X_2(4J5D)
PPIF_HUMAN
[Raw transfer]




7I6_X_2(4J5C)
PPIF_HUMAN
[Raw transfer]




53Z_A_2(4J58)
PPIF_HUMAN
[Raw transfer]




7I6_A_2(4ZSD)
?
[Raw transfer]




WM3_A_2(4N1R)
?
[Raw transfer]




GOL_D_4(2HQ6)
CWC27_HUMAN
[Raw transfer]




ALA_A_2(2CFE)
?
[Raw transfer]




EOV_A_3(3EOV)
?
[Raw transfer]

-

WM2_A_2(4N1Q)
?
[Raw transfer]




WM4_A_2(4N1S)
?
[Raw transfer]




EOV_B_4(3EOV)
?
[Raw transfer]

-

PEG_A_2(4O8H)
PPIF_HUMAN
[Raw transfer]




1FP_X_3(3RCK)
PPIF_HUMAN
[Raw transfer]




UNU_A_2(4N1N)
?
[Raw transfer]




FP6_A_2(3R54)
PPIF_HUMAN
[Raw transfer]




GLY_A_2(2IGW)
CYP3_CAEEL
[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




ALA_B_2(1E8K)
CYP3_CAEEL
[Raw transfer]




GOL_C_4(2A2N)
PPWD1_HUMAN
[Raw transfer]




EDO_A_2(3S6M)
?
[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




PRO_B_3(1E8K)
CYP3_CAEEL
[Raw transfer]




PRO_A_3(2IGW)
CYP3_CAEEL
[Raw transfer]




CHAIN_H_8(4TOT)
PPIF_RAT
[Raw transfer]

-

CHAIN_B_2(1VDN)
CYPH_YEAST
[Raw transfer]

-

CHAIN_H_8(4TOT)
PPIF_RAT
[Raw transfer]

-

CHAIN_G_7(4TOT)
PPIF_RAT
[Raw transfer]

-

CHAIN_H_8(2RMC)
PPIC_MOUSE
[Raw transfer]

-

PRO_A_3(2CFE)
?
[Raw transfer]




MIO_X_3(3RDA)
PPIF_HUMAN
[Raw transfer]




DMS_X_4(2BIU)
PPIF_HUMAN
[Raw transfer]




M3I_X_4(3RCI)
PPIF_HUMAN
[Raw transfer]




WM1_A_3(4N1P)
?
[Raw transfer]




ALA_B_3(2QER)
?
[Raw transfer]




6AI_A_3(3R56)
PPIF_HUMAN
[Raw transfer]




SER_A_2(2IGV)
CYP3_CAEEL
[Raw transfer]




DTT_A_2(1H0P)
CYP5_CAEEL
[Raw transfer]




5MZ_A_3(3RDB)
PPIF_HUMAN
[Raw transfer]




5AO_A_2(3RCL)
PPIF_HUMAN
[Raw transfer]




WM4_A_3(4N1S)
?
[Raw transfer]




3AO_A_2(3R59)
PPIF_HUMAN
[Raw transfer]




ACE_B_3(1VDN)
CYPH_YEAST
[Raw transfer]




N3M_A_5(3R57)
PPIF_HUMAN
[Raw transfer]




Q8A_A_3(3R49)
PPIF_HUMAN
[Raw transfer]




4SO_A_3(3R4G)
PPIF_HUMAN
[Raw transfer]




CHAIN_D_4(1XQ7)
?
[Raw transfer]

-

CHAIN_E_5(1XQ7)
?
[Raw transfer]

-

CHAIN_V_6(2POY)
?
[Raw transfer]

-

BS4_A_3(3RCF)
PPIF_HUMAN
[Raw transfer]




CHAIN_N_4(2Z6W)
PPIF_HUMAN
[Raw transfer]

-

CHAIN_C_3(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_B_2(4HY7)
?
[Raw transfer]

-

CHAIN_C_3(3PMP)
?
[Raw transfer]

-

CHAIN_C_3(3PMP)
?
[Raw transfer]

-

CHAIN_F_4(4JJM)
?
[Raw transfer]

-

1FP_X_5(3RCK)
PPIF_HUMAN
[Raw transfer]




CHAIN_F_6(1XQ7)
?
[Raw transfer]

-

CHAIN_D_4(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_F_6(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_C_2(1CYN)
PPIB_HUMAN
[Raw transfer]

-

CHAIN_N_12(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_B_2(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_D_4(1QNH)
?
[Raw transfer]

-

CHAIN_T_4(2POY)
?
[Raw transfer]

-

CHAIN_L_10(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_M_3(2Z6W)
PPIF_HUMAN
[Raw transfer]

-

CHAIN_D_4(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_D_2(1QNG)
?
[Raw transfer]

-

3EP_A_3(1E3B)
CYP3_CAEEL
[Raw transfer]




CHAIN_M_11(2ESL)
PPIC_HUMAN
[Raw transfer]

-

MIO_X_5(3RDA)
PPIF_HUMAN
[Raw transfer]




CHAIN_D_4(3PMP)
?
[Raw transfer]

-

CHAIN_B_2(2RMC)
PPIC_MOUSE
[Raw transfer]

-

CHAIN_E_3(4JJM)
?
[Raw transfer]

-

CHAIN_L_10(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1QNH)
?
[Raw transfer]

-

CHAIN_E_5(3BO7)
?
[Raw transfer]

-

CHAIN_M_11(2ESL)
PPIC_HUMAN
[Raw transfer]

-

CHAIN_B_2(2WFJ)
PPIG_HUMAN
[Raw transfer]

-

LSA_A_6(4N1O)
?
[Raw transfer]




CHAIN_N_12(2ESL)
PPIC_HUMAN
[Raw transfer]

-

DMS_X_5(2BIU)
PPIF_HUMAN
[Raw transfer]




117 HHSearch 91.8954% -73 - C7 -2A2N 2.8 PPWD1_HUMAN
1 PsiBlast_PDB 91.5051% -75 - C7 -2A2N - PPWD1_HUMAN -
116 HHSearch 91.3053% -84 - C7 -2FU0 - ? -
21 PsiBlast_CBE 91.0551% -75 - C7 -2A2N - -
2 PsiBlast_PDB 90.7745% -89 - C7 -2FU0 - ? -
3 PsiBlast_PDB 89.8543% -81 - C7 -1XYH - PPIL3_HUMAN -
122 HHSearch 89.7245% -74 - C7 -1ZKC - PPIL2_HUMAN -
22 PsiBlast_CBE 89.7143% -87 - C7 -2OJU 6.0 PPIL3_HUMAN
4 PsiBlast_PDB 89.0743% -81 - C7 -2OK3 - PPIL3_HUMAN -
124 HHSearch 89.0450% -72 - C7 -2OK3 - PPIL3_HUMAN -
137 HHSearch 88.8346% -77 - C7 -1IHG - PPID_BOVIN -
5 PsiBlast_PDB 88.0943% -88 - C7 -2OJU 6.6 PPIL3_HUMAN
135 HHSearch 88.0753% -70 - C7 -2HAQ - ? -
133 HHSearch 88.0047% -68 * C7 *1A58 - CYP1_BRUMA -
129 HHSearch 87.7945% -74 - C7 -1MZW - PPIH_HUMAN -
121 HHSearch 87.5843% -66 - C7 -2POE 2.6 ?
106 Fugue 87.3044% -55 - C7 -1IIP - PPID_BOVIN -
11 PsiBlast_PDB 87.1748% -80 - C7 -4S1J - ? -
134 HHSearch 87.0046% -70 - C7 -3PMP 8.0 ?
8 PsiBlast_PDB 86.4746% -85 - C7 -1XO7 - ? -
16 PsiBlast_PDB 86.4237% -71 - C7 -2POE 2.6 ?
24 PsiBlast_CBE 86.1546% -80 - C7 -1XQ7 6.0 ?
23 PsiBlast_CBE 86.0946% -79 - C7 -1XQ7 7.8 ?
9 PsiBlast_PDB 85.9246% -79 - C7 -1XQ7 7.3 ?
17 PsiBlast_PDB 85.9037% -73 - C7 -2QER 2.7 ?
20 PsiBlast_PDB 85.3745% -93 - C7 -2CFE 3.4 ?
40 PsiBlast_CBE 85.3145% -87 - C7 -2ESL 8.5 PPIC_HUMAN
126 HHSearch 85.0137% -72 - C7 -3BO7 5.0 ?
41 PsiBlast_CBE 84.8845% -87 - C7 -2ESL 8.1 PPIC_HUMAN
43 PsiBlast_CBE 84.8445% -88 - C7 -2ESL 2.3 PPIC_HUMAN
42 PsiBlast_CBE 84.7745% -89 - C7 -2ESL 2.5 PPIC_HUMAN
28 PsiBlast_CBE 84.6746% -84 - C7 -2RMC 8.5 PPIC_MOUSE
39 PsiBlast_CBE 84.6345% -91 - C7 -2ESL 8.5 PPIC_HUMAN
53 PsiBlast_CBE 84.2142% -84 - C7 -2POY 8.2 ?
44 PsiBlast_CBE 84.1845% -89 - C7 -2ESL 2.5 PPIC_HUMAN
30 PsiBlast_CBE 83.8746% -85 - C7 -2RMC 8.2 PPIC_MOUSE
51 PsiBlast_CBE 83.8042% -83 - C7 -2POY 7.2 ?
123 HHSearch 83.7839% -73 - C7 -2HQ6 2.3 CWC27_HUMAN
31 PsiBlast_CBE 83.6846% -85 - C7 -2RMC 8.6 PPIC_MOUSE
52 PsiBlast_CBE 83.6642% -80 - C7 -2POY Error ?
35 PsiBlast_CBE 83.2942% -86 - C7 -2IGW 3.3 CYP3_CAEEL
54 PsiBlast_CBE 83.2040% -69 - C7 -2WFJ 6.8 PPIG_HUMAN
36 PsiBlast_CBE 83.1242% -84 - C7 -2IGV 4.5 CYP3_CAEEL
29 PsiBlast_CBE 83.1046% -84 - C7 -2RMC 8.4 PPIC_MOUSE
37 PsiBlast_CBE 82.9142% -86 - C7 -1E8K 3.7 CYP3_CAEEL
50 PsiBlast_CBE 82.7042% -88 - C7 -4JJM 7.8 ?
38 PsiBlast_CBE 82.4542% -83 - C7 -1E3B 2.5 CYP3_CAEEL
45 PsiBlast_CBE 82.2145% -80 - C7 -1H0P 2.8 CYP5_CAEEL
49 PsiBlast_CBE 81.6842% -83 - C7 -4JJM 7.6 ?
25 PsiBlast_CBE 81.6347% -83 - C7 -3EOV 5.8 ?
14 PsiBlast_PDB 81.2447% -81 - C7 -3EOV 6.1 ?
105 Fugue 81.1543% -58 - C7 -2RMC 7.3 PPIC_MOUSE
48 PsiBlast_CBE 80.7143% -86 - C7 -1CYN 8.1 PPIB_HUMAN
90 PsiBlast_CBE 80.5845% -88 - C7 -3PMP 7.8 ?
128 HHSearch 79.4940% -75 - C7 -3S6M 2.5 ?
33 PsiBlast_CBE 79.4245% -82 - C7 -4HY7 8.3 ?
55 PsiBlast_CBE 78.8745% -84 - C7 -4TOT Error PPIF_RAT
89 PsiBlast_CBE 78.8345% -86 - C7 -3PMP 8.1 ?
15 PsiBlast_PDB 78.8045% -81 - C7 -1QNG 6.2 ?
56 PsiBlast_CBE 78.7445% -84 - C7 -4TOT Error PPIF_RAT
57 PsiBlast_CBE 78.6645% -85 - C7 -4TOT Error PPIF_RAT
34 PsiBlast_CBE 78.6245% -83 - C7 -1VDN 6.5 CYPH_YEAST
26 PsiBlast_CBE 78.4944% -73 - C7 -1QNH 6.9 ?
70 PsiBlast_CBE 78.1446% -79 - C7 -3R54 2.6 PPIF_HUMAN
69 PsiBlast_CBE 78.1046% -76 - C7 -3R56 2.5 PPIF_HUMAN
60 PsiBlast_CBE 77.9446% -79 - C7 -3RDB 2.9 PPIF_HUMAN
66 PsiBlast_CBE 77.8546% -80 - C7 -3RCF 3.8 PPIF_HUMAN
19 PsiBlast_PDB 77.8344% -78 - C7 -1QNH 6.9 ?
65 PsiBlast_CBE 77.8146% -79 - C7 -3RCI 2.7 PPIF_HUMAN
67 PsiBlast_CBE 77.6746% -79 - C7 -3R59 2.7 PPIF_HUMAN
87 PsiBlast_CBE 77.5146% -78 - C7 -4J58 5.3 PPIF_HUMAN
68 PsiBlast_CBE 77.4846% -82 - C7 -3R57 2.8 PPIF_HUMAN
71 PsiBlast_CBE 77.2946% -77 - C7 -3R4G 2.9 PPIF_HUMAN
61 PsiBlast_CBE 77.2746% -80 - C7 -3RDA 2.7 PPIF_HUMAN
99 PsiBlast_CBE 77.2344% -81 - C7 -4N1S 3.2 ?
85 PsiBlast_CBE 77.1846% -78 - C7 -4J5A 7.0 PPIF_HUMAN
78 PsiBlast_CBE 77.1746% -79 - C7 -4ZSD 5.4 ?
79 PsiBlast_CBE 77.1146% -78 - C7 -4ZSC 4.5 ?
74 PsiBlast_CBE 77.1146% -79 - C7 -4O8H 2.5 PPIF_HUMAN
63 PsiBlast_CBE 77.1046% -79 - C7 -3RCL 2.8 PPIF_HUMAN
75 PsiBlast_CBE 77.0546% -84 - C7 -2Z6W 8.7 PPIF_HUMAN
98 PsiBlast_CBE 77.0244% -80 - C7 -3RDD 3.9 PPIA_HUMAN
77 PsiBlast_CBE 77.0246% -80 - C7 -2BIU 3.5 PPIF_HUMAN
102 PsiBlast_CBE 76.9844% -83 - C7 -4N1P 2.7 ?
82 PsiBlast_CBE 76.9246% -77 - C7 -4J5D 7.8 PPIF_HUMAN
72 PsiBlast_CBE 76.8346% -78 - C7 -3R49 3.0 PPIF_HUMAN
104 PsiBlast_CBE 76.5944% -79 - C7 -4N1N 3.1 ?
86 PsiBlast_CBE 76.5946% -80 - C7 -4J59 7.8 PPIF_HUMAN
100 PsiBlast_CBE 76.5644% -83 - C7 -4N1R 3.0 ?
103 PsiBlast_CBE 76.3144% -80 - C7 -4N1O 3.2 ?
81 PsiBlast_CBE 76.2946% -78 - C7 -4J5E 7.5 PPIF_HUMAN
64 PsiBlast_CBE 76.1846% -77 - C7 -3RCK 2.4 PPIF_HUMAN
59 PsiBlast_CBE 76.1446% -77 - C7 -3RDC 4.6 PPIF_HUMAN
84 PsiBlast_CBE 76.0746% -77 - C7 -4J5B 6.9 PPIF_HUMAN
76 PsiBlast_CBE 75.8446% -79 - C7 -2Z6W 8.0 PPIF_HUMAN
83 PsiBlast_CBE 75.7546% -78 - C7 -4J5C 8.0 PPIF_HUMAN
80 PsiBlast_CBE 74.7846% -75 - C7 -4XNC 4.4 ?
101 PsiBlast_CBE 74.7744% -76 - C7 -4N1Q 3.4 ?