@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2390: (2016-04-03 )
LDEKTKIYDITIIGGGPVGLFAAFYAGMRNASVKIIESLPQLGGQLSTLYPEKYIYDIPGYPSVRAQELVNNLIQQMKPFDPTVALEEAVQSVEKQVDGTFEIITKKDTHYSKAIIITAGNGAFEPRRLDLPEAEQYEGTNIHYFINDLSRFSGRRVAVCGGGDSAVDWALMLEKVASSVAIVHRRNAFRAHEHSVNNLEKSSIAIKTPFIPTEVLGNGDKLTHITLQEVKGDTTETLEIDDFIINYGFVSSLGPIKNWGLELERNSIVVNSKMETSIPGIYCAGDICTYDGKVKLIATGFGEAPTAVNNAMNFIDPKTRVQPMHSTSLFE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_2(3LZW)
FENR2_BACSU
[Raw transfer]




FAD_B_6(3LZX)
FENR2_BACSU
[Raw transfer]




FAD_A_2(3LZW)
FENR2_BACSU
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_A_3(3LZX)
FENR2_BACSU
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_B_4(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_A_4(2ZBW)
FENR_THET8
[Raw transfer]




FAD_A_4(2ZBW)
FENR_THET8
[Raw transfer]




37 HHSearch 97.2871%-122 - C1 -3LZW 13.6 FENR2_BACSU
1 PsiBlast_PDB 97.0570%-121 - C1 -3LZW 13.6 FENR2_BACSU
21 PsiBlast_CBE 96.1970%-122 - C1 -3LZX 13.6 FENR2_BACSU
2 PsiBlast_PDB 95.8470%-121 - C1 -3LZX 13.6 FENR2_BACSU
3 PsiBlast_PDB 86.0543%-120 - C1 -2ZBW 12.4 FENR_THET8
4 PsiBlast_PDB 84.1444%-121 - C1 -3AB1 12.7 FENR_CHLTE
22 PsiBlast_CBE 83.7344%-113 - C1 -3AB1 13.7 FENR_CHLTE
38 HHSearch 82.3543%-108 - C1 -2ZBW 12.4 FENR_THET8
39 HHSearch 81.8942%-118 - C1 -3AB1 12.7 FENR_CHLTE
15 PsiBlast_PDB 74.2330%-104 - C1 -4GCM - TRXB_STAAW -
42 HHSearch 72.9626%-115 * C1 *3R9U - ? -
16 PsiBlast_PDB 72.4328%-109 - C1 -3CTY - ? -
43 HHSearch 72.1925%-110 - C1 -3ITJ - TRXB1_YEAST -
47 HHSearch 71.9327%-107 - C1 -3CTY - ? -
41 HHSearch 71.7924%-118 - C1 -1FL2 - AHPF_ECOLI -
40 HHSearch 71.0625%-117 - C1 -3F8D - ? -
49 HHSearch 71.0028%-107 - C1 -2Q7V - ? -
8 PsiBlast_PDB 70.9526%-106 - C1 -3F8R - ? -
6 PsiBlast_PDB 70.6126%-103 - C1 -3F8D - ? -
7 PsiBlast_PDB 70.5326%-103 - C1 -3F8P - ? -