@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2421: (2016-04-03 )
LKSKLELLFTKISHVMNVWQATFFAAVSWVLALITIQTIYLWSISIRDDSLFLREVSQAIVQLFGTNKYTRIMQSFWMMSLKFLIIFLIACLFFAFFYRLMRQRILKKQLRTINFALNDGKPVDTESFVPEIQELERNIENMRERQKKLMQQEEQAQQARNDLITNVSHDLRTPLTSILGYLSYIHEDRYRDEIELRYYTELVYGKARHLHKLIDDLFSYTRLDSVDYQLKKDELDIVELLRQLVAEYDGRAAERNMQIVEHFDANKLIIGGDGNQIMRLFENLFSNALRYGEGNKQIDVSAKKEDNMAVVRVTNYGEEIPNVDLPYLFERFYKVDKNRTTTGTGLGLAIAKSIVEKHGGIVTAESKKRQTSFIVKLPLI

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_4(3SL2)

[Raw transfer]




ANP_A_3(4KP4)
ENVZ_ECOLI
[Raw transfer]




ADP_A_2(2C2A)
?
[Raw transfer]




ADP_A_2(2C2A)
?
[Raw transfer]




ADP_A_2(4JAU)
?
[Raw transfer]




5 PsiBlast_PDB 91.2530% -93 - C2 -4JAU 6.0 ?
7 PsiBlast_PDB 90.9529% -79 - C2 -4JAV - ? -
8 PsiBlast_PDB 87.7129% -82 - C2 -2C2A 6.6 ?
4 PsiBlast_PDB 87.1430% -79 - C2 -4JAS - ? -
3 PsiBlast_PDB 85.9725% -81 - C2 -4U7O - ? -
6 PsiBlast_PDB 84.4329% -77 - C2 -3DGE - ? -
40 HHSearch 83.9730% -85 - C2 -2C2A 6.6 ?
17 PsiBlast_PDB 83.0626% -65 - C2 -4CB0 - CPXA_ECOLI -
16 PsiBlast_PDB 82.6026% -70 - C2 -4BIV - CPXA_ECOLI -
2 PsiBlast_PDB 82.5925% -88 - C2 -4U7N - ? -
14 PsiBlast_PDB 81.5728% -81 - C2 -4BIX - CPXA_ECOLI -
13 PsiBlast_PDB 81.5528% -78 - C2 -4BIW - CPXA_ECOLI -
18 PsiBlast_PDB 80.1727% -76 - C2 -4BIZ - CPXA_ECOLI -
12 PsiBlast_PDB 80.1028% -80 - C2 -4BIU - CPXA_ECOLI -
15 PsiBlast_PDB 78.6728% -86 - C2 -4BIY - CPXA_ECOLI -
9 PsiBlast_PDB 72.8629% -50 - C2 -4Q20 - DIVL_CAUCR -
1 PsiBlast_PDB 71.8627% -66 - C2 -4I5S - ? -
50 HHSearch 71.5532% -98 * C2 *3SL2 7.7
29 Fugue 70.1520% -62 - C2 -4I5S - ? -
28 Fugue 69.9722% -73 - C2 -1ID0 - -
10 PsiBlast_PDB 68.2730% -45 - C2 -4KP4 7.0 ENVZ_ECOLI