@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2425: (2016-04-03 )
MSLPKDLLYTEEHEWVKADDGSYVIGITDFAQDQLGDIVFVELPEVGDTVTKGDSIGSIESVKTVSDFYAPVTGKVVAVNETLEDEPELINSNPYDTGWILKLEEVEEADVKALLSSDDYEKVLD

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RED_A_3(1DXM)
GCSH_PEA
[Raw transfer]




LPA_A_3(1HPC)
GCSH_PEA
[Raw transfer]




LPA_A_3(1HPC)
GCSH_PEA
[Raw transfer]




OSS_B_2(1HTP)
GCSH_PEA
[Raw transfer]




EDO_B_12(3TZU)
?
[Raw transfer]




EDO_A_8(3TZU)
?
[Raw transfer]




EDO_B_12(3TZU)
?
[Raw transfer]




EDO_A_8(3TZU)
?
[Raw transfer]




EDO_A_8(3TZU)
?
[Raw transfer]




LPA_B_4(1HPC)
GCSH_PEA
[Raw transfer]




RED_B_4(1DXM)
GCSH_PEA
[Raw transfer]




EDO_A_7(3TZU)
?
[Raw transfer]




27 HHSearch 97.8351% -75 - C4 -3A7L - GCSH_ECOLI -
2 PsiBlast_PDB 97.1951% -75 - C4 -3A7L - GCSH_ECOLI -
3 PsiBlast_PDB 97.1550% -82 - C4 -3A8J - GCSH_ECOLI -
4 PsiBlast_PDB 96.6150% -82 - C4 -3A8K - GCSH_ECOLI -
26 HHSearch 95.4846% -84 - C4 -3HGB - GCSH_MYCTU -
1 PsiBlast_PDB 95.2651% -78 - C4 -3A7A - GCSH_ECOLI -
7 PsiBlast_PDB 94.5650% -83 - C4 -3IFT - GCSH_MYCTU -
32 HHSearch 94.5149% -76 - C4 -1ZKO - GCSH_THEMA -
6 PsiBlast_PDB 93.6150% -85 - C4 -3HGB - GCSH_MYCTU -
5 PsiBlast_PDB 92.4650% -78 - C4 -1ONL - GCSH_THET8 -
28 HHSearch 92.2445% -79 - C4 -1HPC 1.5 GCSH_PEA
11 PsiBlast_PDB 91.2047% -85 - C4 -1DXM 1.6 GCSH_PEA
21 PsiBlast_CBE 90.5547% -84 - C4 -1HPC 1.7 GCSH_PEA
22 PsiBlast_CBE 90.2747% -80 - C4 -1DXM 1.4 GCSH_PEA
10 PsiBlast_PDB 90.0947% -80 - C4 -1HPC 1.5 GCSH_PEA
9 PsiBlast_PDB 90.0150% -75 - C4 -1ZKO - GCSH_THEMA -
12 PsiBlast_PDB 89.5047% -81 - C4 -1HTP 2.9 GCSH_PEA
30 HHSearch 88.8538% -78 - C4 -3WDN - GCSH_BOVIN -
15 PsiBlast_PDB 87.7039% -75 - C4 -3WDN - GCSH_BOVIN -
8 PsiBlast_PDB 87.6451% -76 - C4 -2KA7 - GCSH_THEMA -
31 HHSearch 86.3843% -70 - C4 -3TZU 2.8 ?
25 PsiBlast_CBE 84.8844% -63 - C4 -3TZU 2.5 ?
16 PsiBlast_PDB 83.7444% -62 - C4 -3TZU 3.4 ?
24 PsiBlast_CBE 83.1544% -59 - C4 -3TZU 2.8 ?
23 PsiBlast_CBE 82.7544% -59 - C4 -3TZU 2.0 ?