@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2457: (2016-04-03 )
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTDLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEPASFLALLEAVK

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_C_3(1SPQ)
TPIS_CHICK
[Raw transfer]




PGH_B_4(1TPW)
TPIS_CHICK
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_D_4(1SW3)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1SW3)
TPIS_CHICK
[Raw transfer]




PGA_A_3(2J27)
TPIS_TRYBB
[Raw transfer]




PGA_D_4(1SW0)
TPIS_CHICK
[Raw transfer]




PGA_A_3(1SW7)
TPIS_CHICK
[Raw transfer]




PGA_B_4(1SW7)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1SW0)
TPIS_CHICK
[Raw transfer]




PGH_A_3(1TPW)
TPIS_CHICK
[Raw transfer]




PGH_B_4(1TPV)
TPIS_CHICK
[Raw transfer]




PGH_B_4(7TIM)
TPIS_YEAST
[Raw transfer]




PGA_D_4(1SU5)
TPIS_CHICK
[Raw transfer]




PGH_A_3(1TPU)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1QDS)
TPIS_LEIME
[Raw transfer]




PGA_A_2(1N55)
TPIS_LEIME
[Raw transfer]




PGA_B_4(1SSG)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1SU5)
TPIS_CHICK
[Raw transfer]




PGH_A_3(1TPV)
TPIS_CHICK
[Raw transfer]




PGA_A_3(1SSG)
TPIS_CHICK
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




PGH_A_3(7TIM)
TPIS_YEAST
[Raw transfer]




PGH_B_4(1TPU)
TPIS_CHICK
[Raw transfer]




1GP_A_2(2Y61)
TPIS_LEIME
[Raw transfer]




BBR_A_2(2Y63)
TPIS_LEIME
[Raw transfer]




G3P_A_2(2Y62)
TPIS_LEIME
[Raw transfer]




TRS_H_8(2I9E)
?
[Raw transfer]




3PY_A_4(1O5X)
TPIS_PLAFA
[Raw transfer]




UVW_A_4(4MVA)
?
[Raw transfer]




PEG_B_9(4MVA)
?
[Raw transfer]




CIT_A_4(3UWU)
TPIS_STAAR
[Raw transfer]




TRS_I_9(2I9E)
?
[Raw transfer]




101 HHSearch 98.1565% -87 - C8 -2BTM 4.0 TPIS_GEOSE
123 Fugue 98.0765% -88 - C8 -2BTM 4.0 TPIS_GEOSE
1 PsiBlast_PDB 97.7865% -86 - C8 -2BTM - TPIS_GEOSE -
7 PsiBlast_PDB 97.4762% -92 - C8 -3UWY - TPIS_STAAR -
5 PsiBlast_PDB 97.3262% -91 - C8 -3UWV - TPIS_STAAR -
21 PsiBlast_CBE 97.0465% -84 - C8 -2BTM - TPIS_GEOSE -
6 PsiBlast_PDB 96.8262% -93 - C8 -3UWW - TPIS_STAAR -
2 PsiBlast_PDB 96.7664% -85 - C8 -1BTM - TPIS_GEOSE -
4 PsiBlast_PDB 96.7462% -91 - C8 -3UWU 2.9 TPIS_STAAR
108 HHSearch 96.6863% -91 - C8 -3M9Y - TPIS_STAAR -
8 PsiBlast_PDB 96.4762% -91 - C8 -3UWZ - TPIS_STAAR -
26 PsiBlast_CBE 96.4462% -90 - C8 -3UWV - TPIS_STAAR -
25 PsiBlast_CBE 96.4162% -92 - C8 -3UWW - TPIS_STAAR -
23 PsiBlast_CBE 96.3462% -91 - C8 -3M9Y - TPIS_STAAR -
27 PsiBlast_CBE 95.8662% -92 - C8 -3UWU - TPIS_STAAR -
3 PsiBlast_PDB 95.8362% -93 - C8 -3M9Y - TPIS_STAAR -
22 PsiBlast_CBE 95.4464% -83 - C8 -1BTM - TPIS_GEOSE -
24 PsiBlast_CBE 94.6162% -92 - C8 -3UWZ - TPIS_STAAR -
9 PsiBlast_PDB 92.6658% -90 - C8 -4Y8F - ? -
103 HHSearch 91.4947% -86 - C8 -1B9B - PGKT_THEMA -
49 PsiBlast_CBE 85.3641% -79 - C8 -4MVA 3.7 ?
122 Fugue 85.1342% -75 - C8 -1IF2 4.3 TPIS_LEIME
97 PsiBlast_CBE 85.0442% -78 - C8 -1N55 3.4 TPIS_LEIME
91 PsiBlast_CBE 84.9041% -71 - C8 -1TPV 3.5 TPIS_CHICK
109 HHSearch 84.8542% -77 - C8 -2VXN 4.3 TPIS_LEIME
46 PsiBlast_CBE 84.8043% -81 - C8 -2I9E 3.0 ?
92 PsiBlast_CBE 84.7842% -77 - C8 -2Y63 3.1 TPIS_LEIME
94 PsiBlast_CBE 84.6442% -76 - C8 -2Y61 3.8 TPIS_LEIME
93 PsiBlast_CBE 84.6442% -78 - C8 -2Y62 3.7 TPIS_LEIME
95 PsiBlast_CBE 84.5242% -77 - C8 -2VXN 4.3 TPIS_LEIME
44 PsiBlast_CBE 84.4943% -84 - C8 -2I9E 2.9 ?
98 PsiBlast_CBE 84.4242% -77 - C8 -1IF2 4.3 TPIS_LEIME
48 PsiBlast_CBE 84.1041% -81 - C8 -4MVA 2.0 ?
64 PsiBlast_CBE 83.8142% -73 - C8 -1SW7 4.1 TPIS_CHICK
96 PsiBlast_CBE 83.6242% -77 - C8 -1QDS 4.1 TPIS_LEIME
90 PsiBlast_CBE 83.5041% -70 - C8 -1TPV 2.9 TPIS_CHICK
104 HHSearch 83.3838% -82 - C8 -2J27 2.8 TPIS_TRYBB
71 PsiBlast_CBE 83.1941% -72 - C8 -1SW3 3.3 TPIS_CHICK
82 PsiBlast_CBE 83.1241% -67 - C8 -1TPU 3.5 TPIS_CHICK
75 PsiBlast_CBE 83.1141% -73 - C8 -1SSG 3.1 TPIS_CHICK
65 PsiBlast_CBE 83.0942% -71 - C8 -1SW7 3.2 TPIS_CHICK
85 PsiBlast_CBE 83.0241% -73 - C8 -1SW0 3.1 TPIS_CHICK
81 PsiBlast_CBE 82.9241% -72 - C8 -1SU5 3.3 TPIS_CHICK
99 PsiBlast_CBE 82.8840% -73 - C8 -7TIM 3.5 TPIS_YEAST
83 PsiBlast_CBE 82.8541% -72 - C8 -1TPU 3.7 TPIS_CHICK
69 PsiBlast_CBE 82.7741% -76 - C8 -1SPQ Error TPIS_CHICK
72 PsiBlast_CBE 82.5841% -74 - C8 -1TPW 3.9 TPIS_CHICK
70 PsiBlast_CBE 82.4041% -72 - C8 -1SW3 3.2 TPIS_CHICK
80 PsiBlast_CBE 82.3441% -69 - C8 -1SU5 3.1 TPIS_CHICK
73 PsiBlast_CBE 82.1441% -70 - C8 -1TPW 4.6 TPIS_CHICK
84 PsiBlast_CBE 82.0141% -70 - C8 -1SW0 3.2 TPIS_CHICK
100 PsiBlast_CBE 81.8140% -75 - C8 -7TIM 3.9 TPIS_YEAST
74 PsiBlast_CBE 81.7541% -71 - C8 -1SSG 3.7 TPIS_CHICK
111 HHSearch 80.2737% -82 - C8 -1O5X 3.2 TPIS_PLAFA