@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2462: (2016-04-03 )
MRVIDTHCDALYKLQAGKGKYTFQDAEELDVNFERLIEAKMLLQGFAIFLDEDIPVEHKWKKAVEQVNIFKQHVLHKGGIIHHVKKWCDLENLPEDKIGAMLTLEGIEPIGRDLDKLTQLLDGGVLSVGLTWNNANLAADGIMEERGAGLTRFGKDIIHLLNERKVFTDVSHLSVKAFWETLEQAEFVIASHSSAKAICAHPRNLDDEQIKAMIEHDAMIHVIFHPLFTTNDGVADIEDVIRHIDHICELGGMKNIGFGSDFDGIPDHVKGLEHAGKYQNFLETLGKHYTKEEVEGFASRNFLNHLPK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

L3A_B_6(3NEH)
?
[Raw transfer]




L3A_A_3(3NEH)
?
[Raw transfer]




2 PsiBlast_PDB 99.0198%-115 - C4 -3LU2 - ? -
21 PsiBlast_CBE 98.5096%-117 - C4 -3NEH 4.3 ?
1 PsiBlast_PDB 98.0096%-115 - C4 -3NEH - ? -
22 HHSearch 97.5296%-113 - C4 -3NEH 4.6 ?
42 Fugue 72.5126% -89 - C4 -1ITU - DPEP1_HUMAN -
28 HHSearch 71.4527% -83 - C4 -1ITU - DPEP1_HUMAN -
9 PsiBlast_PDB 69.8324% -90 - C4 -3S2J - ? -
7 PsiBlast_PDB 69.7624% -92 - C4 -3ITC - ? -
11 PsiBlast_PDB 69.6524% -91 - C4 -3S2M - ? -
26 HHSearch 69.3926% -89 - C4 -3ID7 - ? -
8 PsiBlast_PDB 69.3224% -91 - C4 -3ISI - ? -
12 PsiBlast_PDB 69.1924% -91 - C4 -3S2N - ? -
10 PsiBlast_PDB 68.9924% -91 - C4 -3S2L - ? -
6 PsiBlast_PDB 68.6524% -92 - C4 -3K5X - ? -
5 PsiBlast_PDB 68.4824% -90 - C4 -3ID7 - ? -
23 HHSearch 67.3520% -90 - C4 -2RAG - ? -
27 HHSearch 65.9725% -83 - C4 -3LY0 - ? -
3 PsiBlast_PDB 64.8428% -80 - C4 -1ITQ - DPEP1_HUMAN -
24 HHSearch 64.8320% -90 * C4 *3B40 - ? -
4 PsiBlast_PDB 63.8228% -81 - C4 -1ITU - DPEP1_HUMAN -