@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2471: (2016-04-04 )
MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILEATAVQEVGRISEFDLGLWNDEQVPALKKLVGGLHYHGAKAGIQLAHAGRKAVLPGEIVAPSAIAFDEKSDKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPITNRREDNYGGPAGNRYKILSDIIKAVKEVWDGPIIVRVSATDYAHGGLQLEDHIPFAKWMKADGVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEILCNERADLIIVGRELLRNPYFAKDAAKQLGETIEAPKQYSRAWK

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_7(1Z41)
NAMA_BACSU
[Raw transfer]




FMN_A_3(3GR7)
NAMA_GEOKA
[Raw transfer]




FMN_C_3(1ICQ)
OPR1_SOLLC
[Raw transfer]




FMN_D_4(1ICQ)
OPR1_SOLLC
[Raw transfer]




FMN_B_5(3HGR)
OPR1_SOLLC
[Raw transfer]




FMN_A_3(3HGR)
OPR1_SOLLC
[Raw transfer]




FMN_D_4(1ICS)
OPR1_SOLLC
[Raw transfer]




FMN_C_3(1ICS)
OPR1_SOLLC
[Raw transfer]




FMN_A_6(1ICP)
OPR1_SOLLC
[Raw transfer]




FMN_A_2(3TJL)
?
[Raw transfer]




FMN_A_2(4DF2)
?
[Raw transfer]




FMN_A_2(4M5P)
?
[Raw transfer]




FMN_B_7(1ICP)
OPR1_SOLLC
[Raw transfer]




FMN_B_7(4JIC)
?
[Raw transfer]




FMN_A_2(4QNW)
OYE3_ASPFU
[Raw transfer]




FMN_A_2(3UPW)
?
[Raw transfer]




FMN_A_3(4A3U)
?
[Raw transfer]




FMN_B_6(2HSA)
OPR3_SOLLC
[Raw transfer]




FMN_C_3(2HS8)
OPR3_SOLLC
[Raw transfer]




FMN_D_4(2HS8)
OPR3_SOLLC
[Raw transfer]




FMN_A_7(2HSA)
OPR3_SOLLC
[Raw transfer]




FMN_B_5(3HGS)
OPR3_SOLLC
[Raw transfer]




FMN_A_3(3HGS)
OPR3_SOLLC
[Raw transfer]




FMN_A_3(2HS6)
OPR3_SOLLC
[Raw transfer]




FMN_B_5(2HS6)
OPR3_SOLLC
[Raw transfer]




4CH_A_7(4DF2)
?
[Raw transfer]




PEG_A_5(4JIC)
?
[Raw transfer]




111 HHSearch 98.2562%-103 - C4 -1Z41 9.8 NAMA_BACSU
3 PsiBlast_PDB 98.1261%-103 - C4 -1Z41 - NAMA_BACSU -
5 PsiBlast_PDB 98.0861%-104 - C4 -1Z44 - NAMA_BACSU -
4 PsiBlast_PDB 97.7461%-103 - C4 -1Z42 - NAMA_BACSU -
6 PsiBlast_PDB 97.4361%-104 - C4 -1Z48 - NAMA_BACSU -
2 PsiBlast_PDB 95.2559% -98 - C4 -3GR8 - NAMA_GEOKA -
22 PsiBlast_CBE 95.1359%-101 - C4 -3GR7 - NAMA_GEOKA -
1 PsiBlast_PDB 94.9559%-100 - C4 -3GR7 - NAMA_GEOKA -
112 HHSearch 94.9159%-102 - C4 -3GR7 7.7 NAMA_GEOKA
21 PsiBlast_CBE 94.8459% -98 - C4 -3GR8 - NAMA_GEOKA -
25 PsiBlast_CBE 91.0651%-103 - C4 -3KRZ - ? -
28 PsiBlast_CBE 90.9251%-100 - C4 -3KRU - ? -
24 PsiBlast_CBE 90.8951%-102 - C4 -3KRZ - ? -
26 PsiBlast_CBE 90.5451%-102 - C4 -3KRU - ? -
7 PsiBlast_PDB 90.1651% -99 - C4 -3KRU - ? -
114 HHSearch 90.0452%-100 - C4 -3KRU - ? -
27 PsiBlast_CBE 89.8751%-102 - C4 -3KRU - ? -
8 PsiBlast_PDB 89.8251%-101 - C4 -3KRZ - ? -
113 HHSearch 88.1049% -97 - C4 -3HGJ - ? -
30 PsiBlast_CBE 87.0648% -95 - C4 -3HGJ - ? -
68 PsiBlast_CBE 51.7235% -79 - C4 -4JIC 2.9 ?
67 PsiBlast_CBE 50.7535% -77 - C4 -4JIC 5.8 ?
96 PsiBlast_CBE 50.7032% -80 - C4 -3TJL 4.5 ?
94 PsiBlast_CBE 50.7032% -80 - C4 -4M5P 4.4 ?
95 PsiBlast_CBE 49.5032% -78 - C4 -3UPW 4.4 ?
97 PsiBlast_CBE 49.2532% -81 - C4 -4DF2 4.3 ?
93 PsiBlast_CBE 48.2632% -76 - C4 -1ICP 5.8 OPR1_SOLLC
87 PsiBlast_CBE 48.0232% -76 - C4 -3HGR 5.5 OPR1_SOLLC
90 PsiBlast_CBE 47.9832% -74 - C4 -1ICQ 5.4 OPR1_SOLLC
89 PsiBlast_CBE 47.4832% -73 - C4 -1ICS 5.7 OPR1_SOLLC
92 PsiBlast_CBE 47.3932% -75 - C4 -1ICP 5.6 OPR1_SOLLC
88 PsiBlast_CBE 46.9632% -74 - C4 -1ICS 5.5 OPR1_SOLLC
86 PsiBlast_CBE 46.5732% -73 - C4 -3HGR 5.6 OPR1_SOLLC
91 PsiBlast_CBE 46.3832% -72 - C4 -1ICQ 5.6 OPR1_SOLLC
77 PsiBlast_CBE 44.8034% -77 - C4 -2HS8 4.1 OPR3_SOLLC
85 PsiBlast_CBE 44.2832% -77 - C4 -4QNW 5.3 OYE3_ASPFU
75 PsiBlast_CBE 44.1033% -77 - C4 -4A3U 4.1 ?
78 PsiBlast_CBE 43.9534% -78 - C4 -2HS8 4.1 OPR3_SOLLC
82 PsiBlast_CBE 42.5134% -75 - C4 -2HSA 4.9 OPR3_SOLLC
81 PsiBlast_CBE 42.3634% -73 - C4 -2HSA 4.7 OPR3_SOLLC
79 PsiBlast_CBE 42.2434% -75 - C4 -3HGS 4.7 OPR3_SOLLC
83 PsiBlast_CBE 41.2834% -77 - C4 -2HS6 4.8 OPR3_SOLLC
84 PsiBlast_CBE 40.3534% -75 - C4 -2HS6 4.8 OPR3_SOLLC
80 PsiBlast_CBE 40.0334% -75 - C4 -3HGS 4.8 OPR3_SOLLC