@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2538: (2016-04-04 )
MANVHVINHPLVQHKLTIIRDKNTGTKAFRELVDEVATLMAYEITRDMELEDIQVETPLQTTTAKTLTGKKLGIVPILRAGLGMQDGILKLIPAAKVGHVGLYRDHDTLEPVEYFVKLPSDVEERLFIVVDPMLATGGSAIMAIDCLKKRGARNMKFMCLVAAPEGVKALQDAHPDVEIYVAGLDEKLDENGYIRPGLGDAGDRLFGTK

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

U5P_C_3(1I5E)
UPP_BACCL
[Raw transfer]




U5P_C_3(1I5E)
UPP_BACCL
[Raw transfer]




U5P_D_4(1I5E)
UPP_BACCL
[Raw transfer]




U5P_O_15(1O5O)
UPP_THEMA
[Raw transfer]




U5P_B_11(1UPU)
UPP_TOXGO
[Raw transfer]




U5P_Q_17(1O5O)
UPP_THEMA
[Raw transfer]




U5P_D_9(1UPU)
UPP_TOXGO
[Raw transfer]




U5P_P_16(1O5O)
UPP_THEMA
[Raw transfer]




U5P_A_12(1UPU)
UPP_TOXGO
[Raw transfer]




U5P_N_14(1O5O)
UPP_THEMA
[Raw transfer]




U5P_N_14(1O5O)
UPP_THEMA
[Raw transfer]




PRP_A_4(1VST)
UPP_SULSO
[Raw transfer]




U5P_C_10(1UPU)
UPP_TOXGO
[Raw transfer]




PRP_A_7(3G6W)
UPP_SULSO
[Raw transfer]




PRP_B_16(1JLS)
UPP_TOXGO
[Raw transfer]




URA_A_16(1BD4)
UPP_TOXGO
[Raw transfer]




URA_D_18(1JLS)
UPP_TOXGO
[Raw transfer]




URF_B_19(1UPF)
UPP_TOXGO
[Raw transfer]




URA_B_15(1BD4)
UPP_TOXGO
[Raw transfer]




URA_C_14(1BD4)
UPP_TOXGO
[Raw transfer]




URA_D_13(1BD4)
UPP_TOXGO
[Raw transfer]




URA_A_17(1JLS)
UPP_TOXGO
[Raw transfer]




URF_A_20(1UPF)
UPP_TOXGO
[Raw transfer]




URA_C_19(1JLS)
UPP_TOXGO
[Raw transfer]




URF_D_17(1UPF)
UPP_TOXGO
[Raw transfer]




URF_C_18(1UPF)
UPP_TOXGO
[Raw transfer]




65 HHSearch 97.5075%-148 - C6 -1I5E 5.6 UPP_BACCL
21 PsiBlast_CBE 97.4775%-148 - C6 -1I5E 5.6 UPP_BACCL
1 PsiBlast_PDB 97.4075%-148 - C6 -1I5E 5.6 UPP_BACCL
64 HHSearch 90.1660%-146 - C6 -3DMP - UPP_BURPS -
2 PsiBlast_PDB 88.9359%-143 - C6 -3DMP - UPP_BURPS -
62 HHSearch 88.9058%-145 - C6 -1V9S - UPP_THET2 -
3 PsiBlast_PDB 87.8856%-147 - C6 -1V9S - UPP_THET2 -
4 PsiBlast_PDB 87.8555%-143 - C6 -1O5O 6.8 UPP_THEMA
23 PsiBlast_CBE 87.7355%-140 - C6 -1O5O 6.6 UPP_THEMA
67 HHSearch 87.1955%-142 - C6 -1O5O 6.8 UPP_THEMA
63 HHSearch 87.1853%-134 - C6 -2EHJ - UPP_ECOLI -
24 PsiBlast_CBE 86.9955%-142 - C6 -1O5O 6.3 UPP_THEMA
22 PsiBlast_CBE 86.8255%-144 - C6 -1O5O 6.4 UPP_THEMA
5 PsiBlast_PDB 86.4454%-133 - C6 -2EHJ - UPP_ECOLI -
27 PsiBlast_CBE 86.2954%-134 - C6 -2EHJ - UPP_ECOLI -
26 PsiBlast_CBE 86.2054%-135 - C6 -2EHJ - UPP_ECOLI -
25 PsiBlast_CBE 84.9354%-132 - C6 -2EHJ - UPP_ECOLI -
66 HHSearch 79.5537%-137 - C6 -2E55 - UPP_AQUAE -
28 PsiBlast_CBE 78.5337%-138 - C6 -2E55 - UPP_AQUAE -
6 PsiBlast_PDB 78.3437%-139 - C6 -2E55 - UPP_AQUAE -
43 PsiBlast_CBE 76.9834%-129 - C6 -1UPU 4.8 UPP_TOXGO
16 PsiBlast_PDB 76.0930%-135 - C6 -1VST 5.1 UPP_SULSO
46 PsiBlast_CBE 75.8834%-129 - C6 -1UPF 4.3 UPP_TOXGO
48 PsiBlast_CBE 75.6834%-127 - C6 -1UPF 3.3 UPP_TOXGO
17 PsiBlast_PDB 75.5030%-136 - C6 -3G6W 5.4 UPP_SULSO
37 PsiBlast_CBE 75.3134%-131 - C6 -1BD4 3.9 UPP_TOXGO
47 PsiBlast_CBE 75.2934%-127 - C6 -1UPF 2.8 UPP_TOXGO
11 PsiBlast_PDB 75.2434%-132 - C6 -1UPU 4.4 UPP_TOXGO
39 PsiBlast_CBE 75.1734%-127 - C6 -1BD4 3.2 UPP_TOXGO
32 PsiBlast_CBE 74.9234%-126 - C6 -1JLS 3.0 UPP_TOXGO
45 PsiBlast_CBE 74.8934%-123 - C6 -1UPU 5.4 UPP_TOXGO
31 PsiBlast_CBE 74.7134%-133 - C6 -1JLS 2.4 UPP_TOXGO
44 PsiBlast_CBE 74.5634%-127 - C6 -1UPU 4.8 UPP_TOXGO
33 PsiBlast_CBE 74.3734%-131 - C6 -1JLS 3.3 UPP_TOXGO
8 PsiBlast_PDB 74.3634%-127 - C6 -1BD4 2.9 UPP_TOXGO
12 PsiBlast_PDB 74.1134%-130 - C6 -1UPF 4.3 UPP_TOXGO
9 PsiBlast_PDB 74.0434%-127 - C6 -1JLS 2.9 UPP_TOXGO
38 PsiBlast_CBE 73.8434%-120 - C6 -1BD4 2.3 UPP_TOXGO