@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2544: (2016-04-04 )
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGFISSRIGLKREATPIFSDTNIFEIVVNIKPKPNCVLLDESQFLEKEHVFQLAKIVDELNIPVIAYGLKNDFRNELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPVCRKCHANPPIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THM_A_3(2J9R)
KITH_BACAN
[Raw transfer]




THM_A_9(2B8T)
KITH_UREPA
[Raw transfer]




TTP_A_3(2JA1)
KITH_BACCR
[Raw transfer]




79 HHSearch 91.3229% -89 - C2 -2B8T - KITH_UREPA -
25 PsiBlast_CBE 90.6232%-103 - C2 -2ORW - KITH_THEMA -
81 HHSearch 89.7931%-106 - C2 -2ORW - KITH_THEMA -
82 HHSearch 88.3930% -88 - C2 -1XX6 - KITH_CLOAB -
3 PsiBlast_PDB 87.9929% -87 - C2 -2B8T 6.2 KITH_UREPA
6 PsiBlast_PDB 86.9732% -99 - C2 -2QQ0 - KITH_THEMA -
84 HHSearch 86.9628%-101 - C2 -2J9R - KITH_BACAN -
22 PsiBlast_CBE 85.3832% -95 - C2 -2QQ0 - KITH_THEMA -
21 PsiBlast_CBE 84.5432%-102 - C2 -2QQE - KITH_THEMA -
4 PsiBlast_PDB 84.0832% -95 - C2 -2ORW - KITH_THEMA -
5 PsiBlast_PDB 83.9732%-105 - C2 -2QPO - KITH_THEMA -
7 PsiBlast_PDB 83.7432% -94 - C2 -2QQE - KITH_THEMA -
23 PsiBlast_CBE 82.7732%-102 - C2 -2QPO - KITH_THEMA -
69 Fugue 82.5521% -95 * C2 *1W4R - KITH_HUMAN -
1 PsiBlast_PDB 81.3727% -66 - C2 -2JA1 7.3 KITH_BACCR
2 PsiBlast_PDB 81.2527% -86 - C2 -2J9R 5.7 KITH_BACAN
24 PsiBlast_CBE 80.3132%-100 - C2 -2QPO - KITH_THEMA -
12 PsiBlast_PDB 78.2520% -96 - C2 -2ORV - KITH_HUMAN -
83 HHSearch 77.2822% -77 - C2 -2ORV - KITH_HUMAN -
8 PsiBlast_PDB 76.6425% -82 - C2 -2J87 - KITH_VACCA -