@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2556: (2016-04-04 )
MPIVNMTDMLKKALAGKYAVGQFNINNLEWTQAILKAAEAEKAPVILGVSEGAAKYMGGFKTVVKMTEGLVEDLKITVPVAIHLDHGSSFDSCKAAIDAGFSSVMIDGSHHPIDENIAMTKQVVDYAHAKGVSVEAEIGTVGGDEDGVTGGINYADPQECLRVVKEANIDALAAALGSVHGPYHGEPVLGFDEMKEISELTGAPLVLHGGSGIPEHQIKKAIELGHSKINVNTECQIVWTAAVREKLATDDKVYDPRKVIGPGVDAIIKTVTEKIQEFGSNGKA

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PH4_A_5(3C56)
ALF_HELPY
[Raw transfer]




TD4_B_10(3N9S)
?
[Raw transfer]




2FP_A_2(3ELF)
ALF_MYCTU
[Raw transfer]




2FP_A_2(3ELF)
ALF_MYCTU
[Raw transfer]




13P_A_8(3Q94)
?
[Raw transfer]




PGH_A_4(2ISW)
?
[Raw transfer]




13P_A_5(2FJK)
ALF_THECA
[Raw transfer]




PGH_A_5(2ISV)
?
[Raw transfer]




PGH_B_12(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_B_6(2ISV)
?
[Raw transfer]




PGH_A_4(2ISW)
?
[Raw transfer]




PGH_A_9(3C52)
ALF_HELPY
[Raw transfer]




13P_A_2(3EKZ)
ALF_MYCTU
[Raw transfer]




FLC_B_6(4TO8)
?
[Raw transfer]




FLC_A_4(4TO8)
?
[Raw transfer]




G3P_A_4(3EKZ)
ALF_MYCTU
[Raw transfer]




8HC_A_4(4LV4)
ALF_MYCTU
[Raw transfer]




1 PsiBlast_PDB 97.7867% -89 - C2 -3Q94 4.4 ?
2 PsiBlast_PDB 93.3865% -94 - C2 -4TO8 3.0 ?
21 PsiBlast_CBE 92.7665% -93 - C2 -4TO8 2.9 ?
53 HHSearch 84.0847% -82 * C2 *2ISW 4.0 ?
4 PsiBlast_PDB 83.8243% -83 - C2 -2ISV 3.6 ?
5 PsiBlast_PDB 83.1543% -82 - C2 -2ISW 4.0 ?
22 PsiBlast_CBE 83.1143% -86 - C2 -3GAK - ? -
23 PsiBlast_CBE 82.9843% -83 - C2 -2ISV 4.2 ?
55 HHSearch 82.2845% -78 - C2 -1RVG - ? -
6 PsiBlast_PDB 81.4940% -83 - C2 -1RV8 - ? -
8 PsiBlast_PDB 81.0841% -79 - C2 -2FJK 4.0 ALF_THECA
54 HHSearch 80.8539% -85 - C2 -1GVF 3.5 KBAY_ECOLI
3 PsiBlast_PDB 80.6743% -84 - C2 -3GAK - ? -
28 PsiBlast_CBE 80.5740% -80 - C2 -1RV8 - ? -
26 PsiBlast_CBE 80.5440% -82 - C2 -1RVG - ? -
25 PsiBlast_CBE 80.4840% -82 - C2 -1RVG - ? -
31 PsiBlast_CBE 80.3838% -81 - C2 -3N9R - ? -
24 PsiBlast_CBE 80.2140% -79 - C2 -1RVG - ? -
7 PsiBlast_PDB 80.2140% -81 - C2 -1RVG - ? -
32 PsiBlast_CBE 80.1338% -80 - C2 -3N9R - ? -
13 PsiBlast_PDB 79.8338% -86 - C2 -1GVF 3.5 KBAY_ECOLI
30 PsiBlast_CBE 79.6338% -81 - C2 -3N9S 5.6 ?
11 PsiBlast_PDB 79.1638% -82 - C2 -3C56 4.4 ALF_HELPY
38 PsiBlast_CBE 78.2938% -82 - C2 -1GVF 4.0 KBAY_ECOLI
10 PsiBlast_PDB 78.2338% -83 - C2 -3C52 4.0 ALF_HELPY
45 Fugue 78.0140% -83 - C2 -1GVF 3.5 KBAY_ECOLI
56 HHSearch 69.5032% -72 - C2 -3ELF 4.8 ALF_MYCTU