@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2692: (2016-04-06 )
LKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFIIGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BA_C_7(4RWW)
?
[Raw transfer]




2BA_B_6(4RWW)
?
[Raw transfer]




2BA_A_2(4WK1)
?
[Raw transfer]




2BA_C_6(4D3H)
?
[Raw transfer]




2BA_B_5(4D3H)
?
[Raw transfer]




2BA_C_6(4D3H)
?
[Raw transfer]




2 PsiBlast_PDB 90.8399%-132 - C8 -4RWW - ? -
21 PsiBlast_CBE 90.7999%-142 - C8 -4RWW 6.8 ?
22 PsiBlast_CBE 89.6599%-144 - C8 -4RWW 7.7 ?
3 PsiBlast_PDB 83.4465%-131 - C8 -4RLE - YAAQ_BACSU -
1 PsiBlast_PDB 80.9599%-142 - C8 -4RWX - ? -
23 PsiBlast_CBE 77.5960%-127 - C8 -4D3H 4.6 ?
24 PsiBlast_CBE 77.4760%-121 - C8 -4D3H 4.7 ?
4 PsiBlast_PDB 76.0060%-127 - C8 -4WK1 6.2 ?
7 PsiBlast_PDB 75.3860%-126 - C8 -4D3H 6.1 ?
52 HHSearch 75.2656%-125 - C8 -3M05 - ? -
8 PsiBlast_PDB 73.5455%-129 - C8 -3M05 - ? -
5 PsiBlast_PDB 73.2360%-137 - C8 -4WK3 - ? -
6 PsiBlast_PDB 73.0460%-125 - C8 -4D3G - ? -
59 HHSearch 66.5526%-121 - C8 -3NCQ - ? -
53 HHSearch 62.5426%-132 * C8 *2EG2 - GLNB_AQUAE -
58 HHSearch 61.3723%-127 - C8 -3T9Z - ? -
61 HHSearch 61.2224%-112 - C8 -2J9C - Y059_METJA -
66 HHSearch 60.7419%-109 - C8 -3CE8 - ? -
55 HHSearch 60.6929%-116 - C8 -2GW8 - ? -
57 HHSearch 59.6222%-117 - C8 -1HWU - ? -