@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2693: (2016-04-06 )
MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPISEKVRNIVLGIGNEEMDPKTEVLLIAGARRQHVVETIRPALAAGKSVLCDRFMDSSLAYQGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLARIAANKGREVNRLDKEDITYHEKVQAGYEKVINMFPERFMRVDATKTPEEITETILADILRQLA

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

Z5A_A_2(5TMP)
KTHY_ECOLI
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




T5A_A_2(4TMK)
KTHY_ECOLI
[Raw transfer]




16T_B_4(4HLD)
KTHY_STAAR
[Raw transfer]




16T_A_3(4HLD)
KTHY_STAAR
[Raw transfer]




32K_B_4(4QG7)
KTHY_STAAR
[Raw transfer]




32C_B_4(4QGG)
KTHY_STAAR
[Raw transfer]




43N_A_3(4XWA)
KTHY_STAA1
[Raw transfer]




13Y_B_4(4HDC)
KTHY_STAAN
[Raw transfer]




32E_A_3(4QGH)
KTHY_STAAR
[Raw transfer]




32E_B_4(4QGH)
KTHY_STAAR
[Raw transfer]




32C_A_3(4QGG)
KTHY_STAAR
[Raw transfer]




43N_B_4(4XWA)
KTHY_STAA1
[Raw transfer]




31Z_B_4(4QGA)
KTHY_STAAR
[Raw transfer]




13Y_A_3(4HDC)
KTHY_STAAN
[Raw transfer]




31Z_A_3(4QGA)
KTHY_STAAR
[Raw transfer]




ATM_A_5(4GMD)
KTHY_PSEAE
[Raw transfer]




TYD_A_4(3HJN)
KTHY_THEMA
[Raw transfer]




32K_A_3(4QG7)
KTHY_STAAR
[Raw transfer]




ATM_D_15(4GMD)
KTHY_PSEAE
[Raw transfer]




ATM_B_8(4GMD)
KTHY_PSEAE
[Raw transfer]




32B_A_3(4QGF)
KTHY_STAAR
[Raw transfer]




ATM_C_12(4GMD)
KTHY_PSEAE
[Raw transfer]




T05_B_4(4HLC)
KTHY_STAAR
[Raw transfer]




ATM_B_4(4EAQ)
KTHY_STAAM
[Raw transfer]




THM_A_4(3N2I)
KTHY_VIBCH
[Raw transfer]




T05_A_3(4HLC)
KTHY_STAAR
[Raw transfer]




TMP_B_4(2CCG)
KTHY_STAAM
[Raw transfer]




ATM_A_3(4EAQ)
KTHY_STAAM
[Raw transfer]




TMP_A_3(3LV8)
KTHY_VIBCH
[Raw transfer]




0Y5_A_3(4GSY)
KTHY_STAAR
[Raw transfer]




TMP_A_3(2CCG)
KTHY_STAAM
[Raw transfer]




0YB_A_3(4GFD)
KTHY_STAAM
[Raw transfer]




TMP_A_3(3LV8)
KTHY_VIBCH
[Raw transfer]




THM_B_6(3N2I)
KTHY_VIBCH
[Raw transfer]




0DJ_B_4(3UWO)
KTHY_PSEAE
[Raw transfer]




TMP_A_6(2CCJ)
KTHY_STAAM
[Raw transfer]




14D_A_3(4HEJ)
KTHY_STAAN
[Raw transfer]




0DJ_A_3(3UWO)
KTHY_PSEAE
[Raw transfer]




0DF_B_5(3UWK)
KTHY_PSEAE
[Raw transfer]




THM_A_2(4ESH)
KTHY_PSEAE
[Raw transfer]




0DN_C_11(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_A_7(3UXM)
KTHY_PSEAE
[Raw transfer]




0DF_A_3(3UWK)
KTHY_PSEAE
[Raw transfer]




0DN_B_8(3UXM)
KTHY_PSEAE
[Raw transfer]




0DN_D_12(3UXM)
KTHY_PSEAE
[Raw transfer]




MRD_B_7(3V9P)
KTHY_BURTA
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




MRD_A_3(3V9P)
KTHY_BURTA
[Raw transfer]




ADP_A_3(3HJN)
KTHY_THEMA
[Raw transfer]




EDO_B_7(3LD9)
KTHY_EHRCR
[Raw transfer]




EDO_D_10(3LD9)
KTHY_EHRCR
[Raw transfer]




ADP_A_4(4EDH)
KTHY_PSEAE
[Raw transfer]




MES_A_3(4MQB)
KTHY_STAAM
[Raw transfer]




ADP_B_6(3HJN)
KTHY_THEMA
[Raw transfer]




ADP_B_9(4EDH)
KTHY_PSEAE
[Raw transfer]




17 PsiBlast_PDB 98.3348% -75 - C3 -2CCG 5.3 KTHY_STAAM
5 PsiBlast_PDB 97.9748% -82 - C3 -4HEJ 6.9 KTHY_STAAN
21 PsiBlast_CBE 97.7348% -80 - C3 -4XWA 8.3 KTHY_STAA1
32 PsiBlast_CBE 97.4848% -70 - C3 -4DWJ - KTHY_STAAM -
14 PsiBlast_PDB 96.8148% -71 - C3 -4DWJ - KTHY_STAAM -
22 PsiBlast_CBE 96.7048% -77 - C3 -4QGH 7.8 KTHY_STAAR
26 PsiBlast_CBE 96.5248% -80 - C3 -4HLD 7.1 KTHY_STAAR
27 PsiBlast_CBE 96.4548% -79 - C3 -4HLC 7.0 KTHY_STAAR
25 PsiBlast_CBE 96.3048% -77 - C3 -4QG7 7.1 KTHY_STAAR
13 PsiBlast_PDB 95.9848% -78 - C3 -4XWA 8.2 KTHY_STAA1
7 PsiBlast_PDB 95.8848% -74 - C3 -4HLD 7.3 KTHY_STAAR
29 PsiBlast_CBE 95.7748% -79 - C3 -4EAQ 5.8 KTHY_STAAM
18 PsiBlast_PDB 95.7447% -74 - C3 -4MQB 2.0 KTHY_STAAM
1 PsiBlast_PDB 95.7448% -76 - C3 -2CCJ 4.8 KTHY_STAAM
36 PsiBlast_CBE 95.6948% -71 - C3 -2CCG 4.8 KTHY_STAAM
33 PsiBlast_CBE 95.6248% -71 - C3 -4DWJ - KTHY_STAAM -
16 PsiBlast_PDB 95.5748% -72 - C3 -4F4I - KTHY_STAAM -
23 PsiBlast_CBE 95.4248% -79 - C3 -4QGG 8.0 KTHY_STAAR
28 PsiBlast_CBE 95.4048% -77 - C3 -4HDC 8.1 KTHY_STAAN
6 PsiBlast_PDB 95.3648% -75 - C3 -4HLC 7.3 KTHY_STAAR
24 PsiBlast_CBE 95.3548% -78 - C3 -4QGA 7.0 KTHY_STAAR
4 PsiBlast_PDB 94.8248% -75 - C3 -4HDC 8.0 KTHY_STAAN
8 PsiBlast_PDB 94.6648% -73 - C3 -4QG7 7.4 KTHY_STAAR
9 PsiBlast_PDB 94.5848% -73 - C3 -4QGA 7.7 KTHY_STAAR
11 PsiBlast_PDB 94.3548% -72 - C3 -4QGG 8.5 KTHY_STAAR
3 PsiBlast_PDB 94.2948% -75 - C3 -4GSY 8.0 KTHY_STAAR
12 PsiBlast_PDB 94.2848% -71 - C3 -4QGH 8.0 KTHY_STAAR
10 PsiBlast_PDB 94.0748% -76 - C3 -4QGF 7.8 KTHY_STAAR
2 PsiBlast_PDB 92.9448% -74 - C3 -4GFD 8.4 KTHY_STAAM
15 PsiBlast_PDB 92.0348% -73 - C3 -4EAQ 6.0 KTHY_STAAM
51 PsiBlast_CBE 90.5340% -58 - C3 -3HJN 7.8 KTHY_THEMA
52 PsiBlast_CBE 89.9138% -55 - C3 -3N2I 4.8 KTHY_VIBCH
53 PsiBlast_CBE 89.5038% -56 - C3 -3N2I 4.0 KTHY_VIBCH
113 HHSearch 88.1238% -65 - C3 -3HJN 5.6 KTHY_THEMA
54 PsiBlast_CBE 87.5038% -59 - C3 -3LV8 5.2 KTHY_VIBCH
42 PsiBlast_CBE 87.2740% -64 - C3 -3UWK 4.5 KTHY_PSEAE
109 HHSearch 87.2337% -55 - C3 -3LV8 5.2 KTHY_VIBCH
43 PsiBlast_CBE 86.5440% -58 - C3 -3UWK 4.2 KTHY_PSEAE
44 PsiBlast_CBE 85.2840% -64 - C3 -3UWO 4.2 KTHY_PSEAE
61 PsiBlast_CBE 85.1035% -56 - C3 -5TMP 10.3 KTHY_ECOLI
62 PsiBlast_CBE 84.9335% -54 - C3 -4TMK 10.7 KTHY_ECOLI
94 Fugue 84.8034% -63 - C3 -4TMK 10.7 KTHY_ECOLI
45 PsiBlast_CBE 84.7940% -60 - C3 -3UWO 4.2 KTHY_PSEAE
50 PsiBlast_CBE 84.2240% -54 - C3 -3HJN 6.0 KTHY_THEMA
19 PsiBlast_PDB 81.4643% -45 - C3 -4EDH 6.4 KTHY_PSEAE
20 PsiBlast_PDB 81.2243% -54 - C3 -4ESH 4.1 KTHY_PSEAE
48 PsiBlast_CBE 80.9643% -52 - C3 -3UXM 3.8 KTHY_PSEAE
46 PsiBlast_CBE 80.5643% -54 - C3 -3UXM 3.8 KTHY_PSEAE
41 PsiBlast_CBE 79.8843% -49 - C3 -4EDH 6.1 KTHY_PSEAE
104 HHSearch 78.7134% -56 - C3 -3V9P 3.0 KTHY_BURTA
49 PsiBlast_CBE 78.1443% -59 - C3 -3UXM 4.0 KTHY_PSEAE
40 PsiBlast_CBE 78.0743% -48 - C3 -4GMD 6.4 KTHY_PSEAE
39 PsiBlast_CBE 77.9443% -50 - C3 -4GMD 5.5 KTHY_PSEAE
55 PsiBlast_CBE 77.6535% -54 - C3 -3V9P 3.0 KTHY_BURTA
47 PsiBlast_CBE 77.4743% -56 - C3 -3UXM 4.3 KTHY_PSEAE
56 PsiBlast_CBE 77.3335% -51 - C3 -3V9P 3.0 KTHY_BURTA
38 PsiBlast_CBE 77.2343% -53 - C3 -4GMD 5.0 KTHY_PSEAE
37 PsiBlast_CBE 76.9643% -51 - C3 -4GMD 5.5 KTHY_PSEAE
59 PsiBlast_CBE 71.4337% -57 - C3 -3LD9 3.2 KTHY_EHRCR
57 PsiBlast_CBE 71.2237% -58 - C3 -3LD9 3.3 KTHY_EHRCR