@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2737: (2016-04-06 )
MPNIKEIAKLAGVSVTTVSRVLNNHPYVAEEKRVRVQAVIDELDYSPNRSAMDLARGKTNTVGVIIPYNDHPWFDKIVNGILEVAFKNRYSVTLFPTGYDPKEEEKYLMRLKTKQVDGLIITSRANNWDVILPYLAYGPIIACEYVESKEVSCSYIDRVKAYRAGFQFLEDEGYKKVAFTAGRASRESTSTYGKINAYEQVFGPVGDNRFLSECYTLEDGLKAGEHFFAAGKDWPDAIYANGDEVAAGVMYHVKKLGLRVPEDVAILGQENLPIGKVLEITTLDHNLKKLGENAFTIFEQGKLQRIKVEHELIRRKTV

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_M_1(1QPZ)
PURR_ECOLI
[Raw transfer]

-

NACID_B_6(3OQO)
CCPA_BACSU
[Raw transfer]

-

NACID_M_1(1QPZ)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(1BDH)
PURR_ECOLI
[Raw transfer]

-

NACID_E_5(3OQN)
CCPA_BACSU
[Raw transfer]

-

NACID_E_5(3OQM)
CCPA_BACSU
[Raw transfer]

-

NACID_E_5(3OQN)
CCPA_BACSU
[Raw transfer]

-

NACID_E_5(3OQM)
CCPA_BACSU
[Raw transfer]

-

NACID_B_6(3OQO)
CCPA_BACSU
[Raw transfer]

-

12 PsiBlast_PDB 90.3427% -83 - C4 -1QPZ 3.2 PURR_ECOLI
7 PsiBlast_PDB 90.2527% -83 - C4 -1PNR - PURR_ECOLI -
10 PsiBlast_PDB 89.9327% -81 - C4 -1QP0 - PURR_ECOLI -
1 PsiBlast_PDB 89.5527% -83 - C4 -1BDH 3.3 PURR_ECOLI
13 PsiBlast_PDB 89.4627% -83 - C4 -1ZAY - PURR_ECOLI -
2 PsiBlast_PDB 89.3227% -83 - C4 -1QP7 - PURR_ECOLI -
18 PsiBlast_PDB 89.1926% -84 - C4 -1VPW - PURR_ECOLI -
11 PsiBlast_PDB 89.0127% -82 - C4 -1QP4 - PURR_ECOLI -
4 PsiBlast_PDB 88.9427% -82 - C4 -1QQB - PURR_ECOLI -
3 PsiBlast_PDB 88.8427% -82 - C4 -1QQA - PURR_ECOLI -
9 PsiBlast_PDB 88.7627% -81 - C4 -1WET - PURR_ECOLI -
8 PsiBlast_PDB 88.6827% -83 - C4 -1BDI - PURR_ECOLI -
6 PsiBlast_PDB 88.6827% -85 - C4 -1JFS - PURR_ECOLI -
16 PsiBlast_PDB 88.0027% -86 - C4 -1JFT - PURR_ECOLI -
20 PsiBlast_PDB 87.6227% -78 - C4 -2PUA - PURR_ECOLI -
19 PsiBlast_PDB 86.9429% -94 - C4 -1ZVV - CCPA_BACSU -
55 HHSearch 84.4225% -80 * C4 *1QPZ - PURR_ECOLI -
50 HHSearch 84.2628% -76 - C4 -2HSG - CCPA_BACME -
5 PsiBlast_PDB 82.7929% -91 - C4 -2HSG - CCPA_BACME -
23 PsiBlast_CBE 82.4231% -88 - C4 -3OQO 6.1 CCPA_BACSU
22 PsiBlast_CBE 82.1031% -90 - C4 -3OQM 4.6 CCPA_BACSU
17 PsiBlast_PDB 81.6131% -88 - C4 -3OQO 4.8 CCPA_BACSU
14 PsiBlast_PDB 81.4431% -87 - C4 -3OQM 5.6 CCPA_BACSU
15 PsiBlast_PDB 80.8031% -89 - C4 -3OQN 4.2 CCPA_BACSU
21 PsiBlast_CBE 80.5331% -89 - C4 -3OQN 5.7 CCPA_BACSU
44 Fugue 41.7448% -62 - C4 -1QPZ 3.0 PURR_ECOLI