@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2743: (2016-04-06 )
MRFFIDTANVEEIKKANRMGFISGVTTNPSLVAKEGRDFNEVIQEITSIVDGPISGEVVSLEADEMIAEGRVIAKIHPNMVVKIPMTGEGLAAVKVLTEEGIKTNVTLVFSATQALLAARAGATYVSPFLGRLDDIGDDGLVLIRDIADIFEIHGIPTEIISASVRHPIHVIECAKAGADIATVPFKVFEQMLKHPLTDSGIDKFLADWEAAKK

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

I22_A_6(3S1X)
TAL_THEAC
[Raw transfer]




I22_A_6(3S1X)
TAL_THEAC
[Raw transfer]




I22_E_10(3S1X)
TAL_THEAC
[Raw transfer]




I22_B_7(3S1X)
TAL_THEAC
[Raw transfer]




I22_C_8(3S1X)
TAL_THEAC
[Raw transfer]




F6R_E_13(3S1V)
TAL_THEAC
[Raw transfer]




I22_A_3(3TKF)
?
[Raw transfer]




I22_D_9(3S1X)
TAL_THEAC
[Raw transfer]




F6R_B_10(3S1V)
TAL_THEAC
[Raw transfer]




F6R_A_8(3S1V)
TAL_THEAC
[Raw transfer]




E4P_C_9(3S1U)
TAL_THEAC
[Raw transfer]




E4P_E_11(3S1U)
TAL_THEAC
[Raw transfer]




F6R_C_11(3S1V)
TAL_THEAC
[Raw transfer]




E4P_B_7(3S1U)
TAL_THEAC
[Raw transfer]




F6R_D_12(3S1V)
TAL_THEAC
[Raw transfer]




E4P_A_6(3S1U)
TAL_THEAC
[Raw transfer]




GOL_D_12(3S1W)
TAL_THEAC
[Raw transfer]




I22_B_9(3TKF)
?
[Raw transfer]




I22_B_5(3TNO)
?
[Raw transfer]




E4P_D_10(3S1U)
TAL_THEAC
[Raw transfer]




I22_A_3(3TKF)
?
[Raw transfer]




F6R_A_3(3TE9)
?
[Raw transfer]




I22_A_3(3TNO)
?
[Raw transfer]




F6R_A_3(3TK7)
?
[Raw transfer]




F6R_B_4(3TK7)
?
[Raw transfer]




A5P_B_8(3UPB)
?
[Raw transfer]




FLC_C_11(3S1W)
TAL_THEAC
[Raw transfer]




GOL_A_17(3CQ0)
TAL2_YEAST
[Raw transfer]




GOL_A_6(3S0C)
TAL_THEAC
[Raw transfer]




FLC_A_7(3S1W)
TAL_THEAC
[Raw transfer]




FLC_D_13(3S1W)
TAL_THEAC
[Raw transfer]




A5P_A_4(3UPB)
?
[Raw transfer]




FLC_E_15(3S1W)
TAL_THEAC
[Raw transfer]




FLC_B_9(3S1W)
TAL_THEAC
[Raw transfer]




GOL_A_17(3CQ0)
TAL2_YEAST
[Raw transfer]




EDO_A_4(3CLM)
TAL_NEIG1
[Raw transfer]




EDO_A_4(3HJZ)
TAL_PROM9
[Raw transfer]




EDO_A_4(3HJZ)
TAL_PROM9
[Raw transfer]




91 HHSearch 95.8263%-111 - C4 -3R8R - TAL_BACSU -
37 PsiBlast_CBE 95.3563%-113 - C4 -3R8R - TAL_BACSU -
1 PsiBlast_PDB 95.1763%-112 - C4 -3R8R - TAL_BACSU -
21 PsiBlast_CBE 95.1463%-110 - C4 -3R8R - TAL_BACSU -
35 PsiBlast_CBE 93.7863%-116 - C4 -3R8R - TAL_BACSU -
36 PsiBlast_CBE 93.7163%-115 - C4 -3R8R - TAL_BACSU -
47 PsiBlast_CBE 93.1855%-118 - C4 -1VPX - TAL_THEMA -
43 PsiBlast_CBE 93.1355%-116 - C4 -1VPX - TAL_THEMA -
5 PsiBlast_PDB 92.7753%-115 - C4 -3S1U 3.5 TAL_THEAC
65 PsiBlast_CBE 92.7553%-113 - C4 -3S1U 3.2 TAL_THEAC
66 PsiBlast_CBE 92.6853%-112 - C4 -3S1U 3.3 TAL_THEAC
72 PsiBlast_CBE 92.3253%-110 - C4 -3S1W 2.9 TAL_THEAC
67 PsiBlast_CBE 92.1653%-110 - C4 -3S1U 3.9 TAL_THEAC
70 PsiBlast_CBE 92.0353%-108 - C4 -3S1W 2.9 TAL_THEAC
92 HHSearch 91.9757%-113 * C4 *1WX0 - TAL_THET8 -
69 PsiBlast_CBE 91.9553%-112 - C4 -3S1W 3.0 TAL_THEAC
59 PsiBlast_CBE 91.9353%-110 - C4 -3S1X 3.0 TAL_THEAC
71 PsiBlast_CBE 91.8553%-107 - C4 -3S1W 2.9 TAL_THEAC
68 PsiBlast_CBE 91.6353%-111 - C4 -3S1U 3.8 TAL_THEAC
7 PsiBlast_PDB 91.5553%-110 - C4 -3S1X 3.5 TAL_THEAC
60 PsiBlast_CBE 91.5253%-110 - C4 -3S1X 4.1 TAL_THEAC
63 PsiBlast_CBE 91.3953%-110 - C4 -3S1V 3.7 TAL_THEAC
58 PsiBlast_CBE 91.3853%-110 - C4 -3S1X 3.0 TAL_THEAC
93 HHSearch 91.3453%-110 - C4 -3S1X 3.5 TAL_THEAC
62 PsiBlast_CBE 91.2753%-110 - C4 -3S1V 3.6 TAL_THEAC
64 PsiBlast_CBE 91.2253%-111 - C4 -3S1V 3.3 TAL_THEAC
6 PsiBlast_PDB 91.1753%-110 - C4 -3S1V 3.4 TAL_THEAC
8 PsiBlast_PDB 90.8553%-109 - C4 -3S1W 3.9 TAL_THEAC
57 PsiBlast_CBE 90.7153%-111 - C4 -3S1X 4.1 TAL_THEAC
61 PsiBlast_CBE 90.6853%-111 - C4 -3S1V 4.0 TAL_THEAC
4 PsiBlast_PDB 90.3653%-111 - C4 -3S0C 2.5 TAL_THEAC
96 HHSearch 75.7633% -95 - C4 -3HJZ 3.5 TAL_PROM9
99 HHSearch 74.1435% -99 - C4 -3TKF 6.0 ?
97 HHSearch 73.7633% -95 - C4 -3CQ0 2.6 TAL2_YEAST
10 PsiBlast_PDB 70.7931%-115 - C4 -3HJZ 3.2 TAL_PROM9
83 PsiBlast_CBE 69.4233%-119 - C4 -3UPB 4.0 ?
84 PsiBlast_CBE 69.1433%-113 - C4 -3TNO 3.8 ?
13 PsiBlast_PDB 68.9433%-117 - C4 -3UPB 4.3 ?
17 PsiBlast_PDB 68.9332%-116 - C4 -3TKF 4.4 ?
85 PsiBlast_CBE 68.7433%-116 - C4 -3TK7 2.7 ?
16 PsiBlast_PDB 67.8332%-114 - C4 -3TE9 4.4 ?
86 PsiBlast_CBE 67.6732%-114 - C4 -3TKF 5.5 ?
12 PsiBlast_PDB 67.3033%-114 - C4 -3TNO 2.5 ?
11 PsiBlast_PDB 65.9833%-113 - C4 -3TK7 2.9 ?
19 PsiBlast_PDB 64.5730%-106 - C4 -3CQ0 2.2 TAL2_YEAST