@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2758: (2016-04-07 )
MWETKFAKEGLTFDDVLLVPAKSDVLPNDVDLSVEMAPSLKLNVPIWSAGMDTITEAKMAIAIARQGGIGVVHKNMSIEQQAEEIEKVKRSESGVIIDPFYLTPDHQVFAAEHLMGKYRISGVPIVNNEKERKLVGILTNRDLRFISDYSTVIKDVMTKENLVTAPVGTTLKQAEQILQKHRIEKLPLVDEAGILKGLITIKDIEKVIEFPNSAKDKHGRLLAAAAVGITNDTFVRVEKLIEAGVDAIVIDTAHGHSAGVINKISEIRQTFKDVVIVAGNVATAEGARALFEVGVDIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATVAREFGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAMEHGSKDRYFQADAKKLVPEGIEGRVPYKGSVADIIFQLVGGIRSGMGYTGSPDLRHLREEAAFVRMTGAGLRESHPHDIQITKEAPNYSIS

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_4(4X3Z)
?
[Raw transfer]




NAJ_B_7(4QNE)
?
[Raw transfer]




NAJ_A_4(4QNE)
?
[Raw transfer]




NAD_B_8(4X3Z)
?
[Raw transfer]




IMP_A_2(4FXS)
?
[Raw transfer]




IMP_U_21(1JR1)
IMDH2_CRIGR
[Raw transfer]




XMP_A_3(2CU0)
IMDH_PYRHO
[Raw transfer]




XMP_A_3(2CU0)
IMDH_PYRHO
[Raw transfer]




IMP_A_3(5AHM)
?
[Raw transfer]




IMP_A_17(1JR1)
IMDH2_CRIGR
[Raw transfer]




IMP_B_6(4AF0)
?
[Raw transfer]




IMP_A_4(4AF0)
?
[Raw transfer]




RVP_Y_25(1NF7)
IMDH2_HUMAN
[Raw transfer]




IMP_B_6(4FO4)
?
[Raw transfer]




IMP_A_3(4FO4)
?
[Raw transfer]




RVP_A_4(1ME8)
IMDH_TRIFO
[Raw transfer]




IMP_A_5(4IX2)
?
[Raw transfer]




IMP_B_6(4IX2)
?
[Raw transfer]




XMP_A_2(4QQ3)
?
[Raw transfer]




XMP_A_3(3TSD)
?
[Raw transfer]




CPR_B_13(1NFB)
IMDH2_HUMAN
[Raw transfer]




CPR_A_9(1NFB)
IMDH2_HUMAN
[Raw transfer]




IMP_C_8(4IX2)
?
[Raw transfer]




IMP_D_11(4IX2)
?
[Raw transfer]




IMP_A_3(3USB)
?
[Raw transfer]




IMP_A_3(3USB)
?
[Raw transfer]




MYD_U_21(1NF7)
IMDH2_HUMAN
[Raw transfer]




2EY_B_8(4MYA)
?
[Raw transfer]




IMP_A_2(5AHN)
?
[Raw transfer]




Q21_B_18(4MY8)
?
[Raw transfer]




Q21_B_13(4MY8)
?
[Raw transfer]




Q21_A_6(4MY8)
?
[Raw transfer]




2EY_A_4(4MYA)
?
[Raw transfer]




39H_A_6(4QM1)
?
[Raw transfer]




39H_C_9(4QM1)
?
[Raw transfer]




39H_B_8(4QM1)
?
[Raw transfer]




39H_C_10(4QM1)
?
[Raw transfer]




1 PsiBlast_PDB 89.8273% -95 - C2 -3TSB - ? -
114 HHSearch 89.1673%-116 - C- -1ZFJ - IMDH_STRPY -
4 PsiBlast_PDB 88.0670%-116 - C- -1ZFJ - IMDH_STRPY -
113 HHSearch 84.9374%-105 - C2 -3USB 4.7 ?
2 PsiBlast_PDB 84.8673%-101 - C2 -3TSD 6.0 ?
3 PsiBlast_PDB 83.9671%-105 - C2 -3USB 4.7 ?
6 PsiBlast_PDB 81.0753% -99 - C2 -4FXS 6.8 ?
9 PsiBlast_PDB 76.8054%-104 - C2 -4DQW - ? -
21 PsiBlast_CBE 74.5054%-107 - C2 -4DQW - ? -
11 PsiBlast_PDB 68.8249% -94 - C2 -2CU0 6.8 IMDH_PYRHO
115 HHSearch 68.4150% -92 - C2 -2CU0 6.8 IMDH_PYRHO
80 PsiBlast_CBE 68.1539% -91 - C2 -1JR1 6.1 IMDH2_CRIGR
76 PsiBlast_CBE 67.8539% -91 - C2 -1NF7 5.0 IMDH2_HUMAN
75 PsiBlast_CBE 67.8439% -91 - C2 -1NF7 5.0 IMDH2_HUMAN
117 HHSearch 66.6359% -95 - C2 -1VRD - ? -
74 PsiBlast_CBE 66.4139% -98 - C2 -1NFB 5.1 IMDH2_HUMAN
5 PsiBlast_PDB 66.3458% -95 - C2 -1VRD - ? -
8 PsiBlast_PDB 66.3354% -98 - C2 -4AVF - ? -
73 PsiBlast_CBE 66.1139% -96 - C2 -1NFB 5.1 IMDH2_HUMAN
119 HHSearch 65.5252%-100 - C2 -1EEP - IMDH_BORBU -
10 PsiBlast_PDB 64.9454%-104 - C2 -5AHN 5.0 ?
79 PsiBlast_CBE 64.2839% -91 - C2 -1JR1 6.1 IMDH2_CRIGR
116 HHSearch 62.6731% -84 - C2 -1ME8 6.6 IMDH_TRIFO
84 PsiBlast_CBE 62.0840% -95 - C2 -4AF0 6.7 ?
83 PsiBlast_CBE 61.9240% -94 - C2 -4AF0 6.9 ?
26 PsiBlast_CBE 61.4470%-105 - C2 -4QM1 5.1 ?
34 PsiBlast_CBE 61.4370%-106 - C2 -4MYA 5.2 ?
15 PsiBlast_PDB 60.9770%-101 - C2 -4MYA 5.1 ?
19 PsiBlast_PDB 60.8251% -71 - C2 -4FO4 7.0 ?
60 PsiBlast_CBE 60.2451% -66 - C2 -4FO4 7.0 ?
52 PsiBlast_CBE 60.1951% -66 - C2 -4X3Z 5.2 ?
53 PsiBlast_CBE 60.1751% -67 - C2 -4X3Z 5.9 ?
56 PsiBlast_CBE 59.7251% -65 - C2 -4QNE 5.9 ?
13 PsiBlast_PDB 59.6570%-103 - C2 -4MY8 5.6 ?
44 PsiBlast_CBE 59.6270%-104 - C2 -4MY8 5.5 ?
55 PsiBlast_CBE 59.5751% -64 - C2 -4QNE 4.2 ?
43 PsiBlast_CBE 59.3470%-108 - C2 -4MY8 5.4 ?
24 PsiBlast_CBE 58.7670%-101 - C2 -4QM1 5.0 ?
58 PsiBlast_CBE 58.7151% -72 - C2 -4IX2 5.9 ?
18 PsiBlast_PDB 58.6870%-104 - C2 -4QM1 4.8 ?
57 PsiBlast_CBE 58.4951% -73 - C2 -4IX2 5.4 ?
20 PsiBlast_PDB 58.4851% -68 - C2 -4IX2 6.2 ?
25 PsiBlast_CBE 58.2170%-103 - C2 -4QM1 5.0 ?
59 PsiBlast_CBE 58.0951% -66 - C2 -4IX2 5.7 ?
81 PsiBlast_CBE 57.8260% -93 - C2 -5AHM 6.4 ?
54 PsiBlast_CBE 56.4651% -74 - C2 -4QQ3 5.6 ?