@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0014: (2015-11-27 )
MLENDIKKVLYSEEDIILKTKELGAKLTADYAGKNPLLVGVLKGSVPFMAELLKHIDTHVEIDFMVVSSYHGGTTSSGEVKILKDVDTNIEGRDVIFIEDIIDTGRTLKYLRDMFKYRQANSVKVATLFDKPEGRLVDIDADYVCYDIPNEFIVGFGLDYAENYRNLPYVGVLKEEIYSK

Atome Classification :

(90 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BME_D_19(3O7M)
?
[Raw transfer]




3QG_A_7(4RHY)
?
[Raw transfer]




IMP_H_8(1P17)
?
[Raw transfer]




3QG_C_13(4RHY)
?
[Raw transfer]




3QG_D_16(4RHY)
?
[Raw transfer]




3QF_B_8(4RHX)
?
[Raw transfer]




3L8_B_8(4RAQ)
HPRT_HUMAN
[Raw transfer]




3QF_C_11(4RHX)
?
[Raw transfer]




5GP_B_15(3KB8)
?
[Raw transfer]




3QF_A_5(4RHX)
?
[Raw transfer]




3QF_D_14(4RHX)
?
[Raw transfer]




3QG_B_10(4RHY)
?
[Raw transfer]




3L7_A_5(4RAO)
HPRT_HUMAN
[Raw transfer]




3L7_D_14(4RAO)
HPRT_HUMAN
[Raw transfer]




IMP_E_5(1P19)
?
[Raw transfer]




3L7_C_11(4RAO)
HPRT_HUMAN
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




3L8_A_5(4RAQ)
HPRT_HUMAN
[Raw transfer]




IMP_A_2(3ACD)
?
[Raw transfer]




5GP_A_2(3ACC)
?
[Raw transfer]




IMP_H_8(1P19)
?
[Raw transfer]




IMP_F_6(1P17)
?
[Raw transfer]




IMP_F_6(1P19)
?
[Raw transfer]




3QE_B_9(4RHU)
?
[Raw transfer]




IMP_G_7(1P17)
?
[Raw transfer]




3L8_C_11(4RAQ)
HPRT_HUMAN
[Raw transfer]




IMP_G_7(1P19)
?
[Raw transfer]




3QE_A_7(4RHU)
?
[Raw transfer]




IMP_E_5(1G9S)
HPRT_ECOLI
[Raw transfer]




3L8_D_14(4RAQ)
HPRT_HUMAN
[Raw transfer]




45T_F_18(4RHU)
?
[Raw transfer]




IMP_E_5(1P17)
?
[Raw transfer]




45T_D_14(4RHU)
?
[Raw transfer]




PRP_B_10(1I14)
?
[Raw transfer]




PRP_B_10(1P18)
?
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




PRP_B_10(1I0I)
?
[Raw transfer]




5GP_E_5(1G9T)
HPRT_ECOLI
[Raw transfer]




PRP_B_10(1TC2)
?
[Raw transfer]




3L6_D_11(4RAN)
HPRT_HUMAN
[Raw transfer]




5GP_B_4(1PZM)
?
[Raw transfer]




PRP_B_9(1I0L)
?
[Raw transfer]




45T_C_12(4RHU)
?
[Raw transfer]




PRP_B_10(1I13)
?
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




45T_E_16(4RHU)
?
[Raw transfer]




3L6_B_7(4RAN)
HPRT_HUMAN
[Raw transfer]




3L6_A_5(4RAN)
HPRT_HUMAN
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




3L7_B_8(4RAO)
HPRT_HUMAN
[Raw transfer]




3L6_C_9(4RAN)
HPRT_HUMAN
[Raw transfer]




GOL_C_12(3O7M)
?
[Raw transfer]




PRP_A_9(1I14)
?
[Raw transfer]




GOL_A_5(3O7M)
?
[Raw transfer]




PRP_A_9(1I0I)
?
[Raw transfer]




PRP_A_9(1P18)
?
[Raw transfer]




PRP_A_9(1TC2)
?
[Raw transfer]




PRP_A_9(1I13)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




7HP_B_8(1TC2)
?
[Raw transfer]




PRP_A_8(1I0L)
?
[Raw transfer]




7HP_B_8(1P18)
?
[Raw transfer]




IMP_B_10(1YFZ)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




MES_B_7(3HVU)
?
[Raw transfer]




FMB_D_4(1TC1)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




MES_C_9(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




GOL_A_7(4RQB)
?
[Raw transfer]




SUC_B_10(3H83)
?
[Raw transfer]




EPE_B_12(4QYI)
?
[Raw transfer]




5GP_A_6(4RHT)
?
[Raw transfer]




5GP_B_10(4RHT)
?
[Raw transfer]




EPE_C_16(4QYI)
?
[Raw transfer]




5GP_D_18(4RHT)
?
[Raw transfer]




SUC_A_6(3H83)
?
[Raw transfer]




5GP_C_14(4RHT)
?
[Raw transfer]




N_F_6(1G9T)
HPRT_ECOLI
[Raw transfer]




N_F_6(1G9S)
HPRT_ECOLI
[Raw transfer]




POP_A_6(3OZF)
?
[Raw transfer]




SUC_C_21(3KB8)
?
[Raw transfer]




SUC_D_25(3KB8)
?
[Raw transfer]




1 PsiBlast_PDB 93.2062%-134 - C4 -3H83 3.0 ?
23 PsiBlast_CBE 92.6062%-134 - C4 -3KB8 5.6 ?
3 PsiBlast_PDB 91.8862%-136 - C4 -3KB8 5.4 ?
4 PsiBlast_PDB 91.7057%-135 - C4 -4RQB 2.5 ?
29 PsiBlast_CBE 91.5662%-129 - C4 -3H83 4.4 ?
26 PsiBlast_CBE 91.4562%-132 - C4 -3HVU 2.0 ?
110 HHSearch 91.2362%-130 - C4 -3HVU 2.0 ?
24 PsiBlast_CBE 91.1562%-129 - C4 -3HVU 2.2 ?
2 PsiBlast_PDB 91.1562%-130 - C4 -3HVU 2.0 ?
22 PsiBlast_CBE 90.6962%-128 - C4 -3KB8 2.9 ?
21 PsiBlast_CBE 90.2562%-130 - C4 -3KB8 1.8 ?
25 PsiBlast_CBE 90.2462%-131 - C4 -3HVU 2.1 ?
27 PsiBlast_CBE 90.1462%-131 - C4 -3H83 - ? -
8 PsiBlast_PDB 89.1552%-130 - C4 -2GEB - ? -
7 PsiBlast_PDB 89.0053%-129 - C4 -1YFZ 5.2 ?
6 PsiBlast_PDB 88.9753%-132 - C4 -1R3U - ? -
118 HHSearch 88.8352%-128 - C4 -2GEB - ? -
119 HHSearch 88.6353%-126 - C4 -1YFZ 5.2 ?
37 PsiBlast_CBE 88.4048%-132 - C4 -4QYI - ? -
28 PsiBlast_CBE 88.3462%-129 - C4 -3H83 - ? -
34 PsiBlast_CBE 88.3348%-140 - C4 -3O7M Error ?
10 PsiBlast_PDB 87.6948%-135 - C4 -3O7M 2.0 ?
35 PsiBlast_CBE 87.5148%-138 - C4 -3O7M 3.9 ?
30 PsiBlast_CBE 87.4353%-128 - C4 -1YFZ 5.5 ?
50 PsiBlast_CBE 87.0543%-130 - C4 -1P18 6.6 ?
56 PsiBlast_CBE 86.8443%-135 - C4 -1I14 6.6 ?
58 PsiBlast_CBE 86.8143%-132 - C4 -1I0L 6.7 ?
45 PsiBlast_CBE 86.5344%-132 - C4 -1TC2 6.8 ?
62 PsiBlast_CBE 86.4443%-133 - C4 -1I13 7.1 ?
39 PsiBlast_CBE 86.4048%-131 - C4 -4QYI 1.9 ?
60 PsiBlast_CBE 86.0443%-133 - C4 -1I0I 7.0 ?
19 PsiBlast_PDB 86.0044%-133 - C4 -1P19 4.8 ?
47 PsiBlast_CBE 85.9344%-137 - C4 -1P19 4.1 ?
49 PsiBlast_CBE 85.8544%-130 - C4 -1TC1 2.7 ?
9 PsiBlast_PDB 85.0748%-130 - C4 -4QYI 2.3 ?
55 PsiBlast_CBE 84.8643%-132 - C4 -1P17 4.7 ?
57 PsiBlast_CBE 84.1043%-130 - C4 -1I14 4.0 ?
20 PsiBlast_PDB 84.0544%-135 - C4 -1TC1 3.2 ?
53 PsiBlast_CBE 83.8843%-132 - C4 -1P17 4.2 ?
116 HHSearch 83.8443%-130 - C4 -1TC1 3.2 ?
46 PsiBlast_CBE 83.7544%-132 - C4 -1P19 5.2 ?
61 PsiBlast_CBE 83.6843%-129 - C4 -1I0I 4.3 ?
51 PsiBlast_CBE 83.5643%-130 - C4 -1P18 3.7 ?
54 PsiBlast_CBE 83.5343%-128 - C4 -1P17 6.5 ?
52 PsiBlast_CBE 83.4143%-134 - C4 -1P17 5.8 ?
59 PsiBlast_CBE 83.3843%-128 - C4 -1I0L 3.0 ?
63 PsiBlast_CBE 83.2843%-133 - C4 -1I13 3.3 ?
18 PsiBlast_PDB 83.2844%-133 - C4 -1TC2 4.4 ?
74 PsiBlast_CBE 83.0143%-135 - C4 -4RHX 8.9 ?
67 PsiBlast_CBE 82.7143%-133 - C4 -4RHY 7.6 ?
75 PsiBlast_CBE 82.5243%-134 - C4 -4RHU 5.9 ?
64 PsiBlast_CBE 82.1443%-137 - C4 -3ACD 6.3 ?
79 PsiBlast_CBE 82.0043%-134 - C4 -4RHU 5.9 ?
68 PsiBlast_CBE 81.8143%-135 - C4 -4RHY 7.3 ?
73 PsiBlast_CBE 81.3143%-137 - C4 -4RHX 8.2 ?
72 PsiBlast_CBE 81.1743%-138 - C4 -4RHX 8.1 ?
70 PsiBlast_CBE 81.1043%-134 - C4 -4RHY 8.0 ?
69 PsiBlast_CBE 80.8043%-133 - C4 -4RHY 7.9 ?
84 PsiBlast_CBE 80.6543%-134 - C4 -4RHT 3.3 ?
48 PsiBlast_CBE 80.5844%-129 - C4 -1P19 5.8 ?
65 PsiBlast_CBE 80.5443%-137 - C4 -3ACC 6.6 ?
78 PsiBlast_CBE 80.3343%-129 - C4 -4RHU 6.1 ?
112 HHSearch 80.2742%-126 - C4 -3ACD 6.3 ?
86 PsiBlast_CBE 80.1738%-143 - C4 -1PZM 6.2 ?
80 PsiBlast_CBE 79.4743%-130 - C4 -4RHU 5.4 ?
76 PsiBlast_CBE 79.2143%-130 - C4 -4RHU 6.0 ?
71 PsiBlast_CBE 78.7943%-131 - C4 -4RHX 8.3 ?
83 PsiBlast_CBE 78.2343%-136 - C4 -4RHT 3.2 ?
115 HHSearch 77.6138%-127 - C4 -1PZM 6.2 ?
16 PsiBlast_PDB 76.6242%-140 - C4 -1G9T 5.8 HPRT_ECOLI
77 PsiBlast_CBE 76.6143%-128 - C4 -4RHU 5.8 ?
82 PsiBlast_CBE 76.6043%-135 - C4 -4RHT 5.4 ?
43 PsiBlast_CBE 75.9442%-131 - C4 -1G9T 3.4 HPRT_ECOLI
85 PsiBlast_CBE 75.9138%-150 - C4 -1PZM 6.8 ?
81 PsiBlast_CBE 74.7743%-132 - C4 -4RHT 5.3 ?
44 PsiBlast_CBE 74.4442%-130 - C4 -1G9S 3.1 HPRT_ECOLI
15 PsiBlast_PDB 73.7242%-132 - C4 -1G9S 5.1 HPRT_ECOLI
93 PsiBlast_CBE 72.8532%-136 - C4 -4RAO 6.5 HPRT_HUMAN
117 HHSearch 71.9231%-120 - C4 -3OZF 3.3 ?
91 PsiBlast_CBE 71.3432%-141 - C4 -4RAQ 6.5 HPRT_HUMAN
100 PsiBlast_CBE 71.2332%-137 - C4 -4RAN 6.1 HPRT_HUMAN
89 PsiBlast_CBE 71.0132%-135 - C4 -4RAQ 7.3 HPRT_HUMAN
92 PsiBlast_CBE 70.9232%-135 - C4 -4RAQ 6.7 HPRT_HUMAN
96 PsiBlast_CBE 70.8732%-139 - C4 -4RAO 7.8 HPRT_HUMAN
94 PsiBlast_CBE 70.6232%-133 - C4 -4RAO 7.4 HPRT_HUMAN
95 PsiBlast_CBE 70.5732%-137 - C4 -4RAO 6.6 HPRT_HUMAN
90 PsiBlast_CBE 70.2132%-134 - C4 -4RAQ 5.1 HPRT_HUMAN
99 PsiBlast_CBE 69.4932%-130 - C4 -4RAN 5.9 HPRT_HUMAN
98 PsiBlast_CBE 69.1732%-136 - C4 -4RAN 5.8 HPRT_HUMAN
97 PsiBlast_CBE 68.9232%-138 - C4 -4RAN 5.9 HPRT_HUMAN