@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0017: (2015-11-27 )
MSYSNLKLFALSSNKELAKKVSQTIGIPLGQSTVRQFSDGEIQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAESVSVVMPYYGYARQDRKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRQGLVGDDVVVVSPDHGGVTRARKLAQCLKTPIAIIDKRRSVTKMNTSEVMNIIGNIKGKKCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQNSAIEKLIVLDTIYLPEERLIDKIEQISIAELIGEAIIRIHEKRPLSPLFEMNKLK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_B_12(2HCR)
PRPS1_HUMAN
[Raw transfer]




AMP_B_13(3DAH)
?
[Raw transfer]




ABM_F_6(1DKU)
KPRS_BACSU
[Raw transfer]




AMP_A_11(2HCR)
PRPS1_HUMAN
[Raw transfer]




AMP_A_11(3DAH)
?
[Raw transfer]




ADP_A_7(3LRT)
KPRS_THEVO
[Raw transfer]




AMP_B_12(3DAH)
?
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




67 Fugue 97.7664%-155 - C5 -1DKU 2.9 KPRS_BACSU
1 PsiBlast_PDB 97.4363%-156 - C5 -1DKU - KPRS_BACSU -
21 PsiBlast_CBE 97.3763%-156 - C5 -1DKU 3.2 KPRS_BACSU
49 HHSearch 97.2963%-153 - C5 -1DKU 2.9 KPRS_BACSU
22 PsiBlast_CBE 97.0063%-158 - C5 -1DKR - KPRS_BACSU -
7 PsiBlast_PDB 92.3646%-148 - C5 -4LYG - PRPS1_HUMAN -
23 PsiBlast_CBE 92.3553%-147 - C5 -3DAH 3.1 ?
48 HHSearch 92.0754%-147 - C5 -3DAH 3.0 ?
2 PsiBlast_PDB 91.9853%-147 - C5 -3DAH - ? -
24 PsiBlast_CBE 91.9553%-147 - C5 -3DAH 3.7 ?
10 PsiBlast_PDB 91.8546%-148 - C5 -3EFH - PRPS1_HUMAN -
31 PsiBlast_CBE 91.7346%-143 - C5 -3EFH - PRPS1_HUMAN -
33 PsiBlast_CBE 91.4346%-145 - C5 -2H06 - PRPS1_HUMAN -
25 PsiBlast_CBE 91.4046%-146 - C5 -4F8E - PRPS1_HUMAN -
36 PsiBlast_CBE 91.3446%-147 - C5 -4M0U - PRPS1_HUMAN -
11 PsiBlast_PDB 91.3446%-148 - C5 -3S5J - PRPS1_HUMAN -
35 PsiBlast_CBE 91.3346%-148 - C5 -4M0P - PRPS1_HUMAN -
29 PsiBlast_CBE 91.3146%-146 - C5 -4LYG - PRPS1_HUMAN -
27 PsiBlast_CBE 91.3146%-149 - C5 -2H07 - PRPS1_HUMAN -
47 HHSearch 91.2545%-143 * C5 *3S5J - PRPS1_HUMAN -
9 PsiBlast_PDB 90.6546%-145 - C5 -2HCR 4.2 PRPS1_HUMAN
32 PsiBlast_CBE 90.4646%-147 - C5 -2HCR 3.4 PRPS1_HUMAN