Study : gbs0023 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: EDO_A_6(3KRE) / Model_27(3KRE/A) = [3.1] Download519.94-8.27MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL
Complex: EDO_A_7(3KRE) / Model_27(3KRE/A) = [3.2] Download368.24-1.00MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL
Complex: AMP_A_10(4O81) / Model_19(4O81/A) = [5.0] Download922.51-0.26MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL
Complex: AIR_A_3(4FE2) / Model_1(4FE2/A) = [5.1] Download1029.70-3.53MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL
Complex: ADP_A_3(4O7T) / Model_11(4O7T/A) = [5.1] Download1213.556.57MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL
Consensus
[pKd Mean = 4.30]
-810
(s=317)
-1
(s=4)
MNNQLIYTGKAKDIYSTKDENVIRTVYKDQATMLNGARKETIDGKGALNNQISSLIFEKLNMAGVVTHYIEQISKNEQLNKKVDIIPLEVVLRNVTAGSFSKRFGVEEGRVLETPIVEFYYKNDDLNDPFINDEHMKFLGIVNDEEIAYLKGETRRINELLKDWFAQIGLNLIDFKLEFGFDKDGKIILADEFSPDNCRLWDAEGNHMDKDVFRRDLGSLTDVYQVVLEKLIAL