@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0027: (2015-11-27 )
MKIAVFASANGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIPSFAFELKEFENKAAYEQAVVDLLDKHEIDLVCLAGYMKIVGETLLSAYEGRIINIHPTYLPEFPGAHGIKDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVHVPRLADDSLESFETRIHETEYQLYPAVLDSLGIKRK

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GAR_F_6(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_F_6(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C3E)
PUR3_ECOLI
[Raw transfer]




GOL_B_13(3P9X)
?
[Raw transfer]




1 PsiBlast_PDB 97.3778%-144 - C7 -4S1N - ? -
3 PsiBlast_PDB 84.2346%-137 - C7 -3P9X - ? -
103 HHSearch 83.9546%-133 - C7 -3P9X - ? -
21 PsiBlast_CBE 83.8346%-135 - C7 -3P9X 2.4 ?
106 HHSearch 79.1538%-139 - C7 -3AUF - ? -
43 PsiBlast_CBE 78.7331%-130 - C7 -1RC0 - PUR2_HUMAN -
109 HHSearch 78.4335%-141 - C7 -3KCQ - ? -
30 PsiBlast_CBE 78.2036%-134 - C7 -1CDE - PUR3_ECOLI -
12 PsiBlast_PDB 78.0736%-134 - C7 -1CDE - PUR3_ECOLI -
108 HHSearch 78.0036%-124 - C7 -2YWR - ? -
4 PsiBlast_PDB 77.9238%-134 - C7 -3AUF - ? -
105 HHSearch 77.4437%-131 - C7 -1JKX - PUR3_ECOLI -
28 PsiBlast_CBE 77.2136%-134 - C7 -1CDE - PUR3_ECOLI -
11 PsiBlast_PDB 77.1436%-132 - C7 -1JKX - PUR3_ECOLI -
24 PsiBlast_CBE 77.0236%-131 - C7 -1JKX - PUR3_ECOLI -
37 PsiBlast_CBE 76.8231%-131 - C7 -4EW2 - -
29 PsiBlast_CBE 76.7336%-134 - C7 -1CDE - PUR3_ECOLI -
23 PsiBlast_CBE 76.6936%-134 - C7 -1JKX - PUR3_ECOLI -
52 PsiBlast_CBE 76.6531%-132 - C7 -1NJS - -
45 PsiBlast_CBE 76.6331%-129 - C7 -1RBY - -
32 PsiBlast_CBE 75.7936%-132 - C7 -1C2T 2.7 PUR3_ECOLI
10 PsiBlast_PDB 75.6736%-135 - C7 -1C2T 3.2 PUR3_ECOLI
7 PsiBlast_PDB 75.6136%-135 - C7 -1C3E 3.2 PUR3_ECOLI
22 PsiBlast_CBE 75.3036%-131 - C7 -1C3E 2.9 PUR3_ECOLI