@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0038: (2015-11-27 )
MKDLQKYQGIIPAFYACYDDKGDICPERVKALTNYFIDKGVQGLYVNGSSGECIYQSVADRKLVLENVMSVAKGKLTVIAHVACNNTKDSVELAMHAEAIGVDAIAAIPPIYFRLPEYAIADYWNTISQAAPQTDFIIYNIPQLAGVALTSDLYRKMLQNPQVIGVKNSSMPVQDIQNFVAIGGENHIVFNGPDEQFLGGRLMGAAAGIGGTYGVMPELYLTLNQLIVDKDLEKARELQFTINDIITKLCSGHGNMYAVIKSVLEINEQLTIGSVRLPLASVTEEDKPIIKEAAEMIRHAKKQFC

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SI3_A_5(4BWL)
NANA_ECOLI
[Raw transfer]




3PY_B_6(1FDY)
NANA_ECOLI
[Raw transfer]




3PY_A_5(1HL2)
NANA_ECOLI
[Raw transfer]




3PY_A_5(3LCW)
NANA_ECOLI
[Raw transfer]




3PY_A_5(1FDY)
NANA_ECOLI
[Raw transfer]




3PY_D_8(1FDY)
NANA_ECOLI
[Raw transfer]




3PY_C_7(1HL2)
NANA_ECOLI
[Raw transfer]




3PY_C_7(1FDY)
NANA_ECOLI
[Raw transfer]




PYR_D_8(1FDZ)
NANA_ECOLI
[Raw transfer]




PYR_B_6(1FDZ)
NANA_ECOLI
[Raw transfer]




PYR_A_5(1FDZ)
NANA_ECOLI
[Raw transfer]




PYR_C_7(1FDZ)
NANA_ECOLI
[Raw transfer]




PYR_A_5(4UUI)
?
[Raw transfer]




38 PsiBlast_CBE 96.2931%-109 - C7 -3LBC - NANA_ECOLI -
12 PsiBlast_PDB 96.2131%-108 - C7 -1HL2 3.4 NANA_ECOLI
4 PsiBlast_PDB 96.1831%-109 - C7 -2YGY - NANA_ECOLI -
47 PsiBlast_CBE 96.1531%-105 - C7 -1FDZ 3.2 NANA_ECOLI
2 PsiBlast_PDB 96.0831%-108 - C7 -3LCL - NANA_ECOLI -
11 PsiBlast_PDB 95.9731%-108 - C7 -1FDY 2.7 NANA_ECOLI
22 PsiBlast_CBE 95.9431%-107 - C7 -3LCG - NANA_ECOLI -
57 PsiBlast_CBE 95.9331%-105 - C7 -4BWL - NANA_ECOLI -
62 PsiBlast_CBE 95.8831%-106 - C7 -3LCW - NANA_ECOLI -
50 PsiBlast_CBE 95.8731%-104 - C7 -1FDY 2.8 NANA_ECOLI
35 PsiBlast_CBE 95.7931%-108 - C7 -3LBM - NANA_ECOLI -
10 PsiBlast_PDB 95.7431%-107 - C7 -1FDZ 2.9 NANA_ECOLI
48 PsiBlast_CBE 95.6331%-107 - C7 -1FDY 2.5 NANA_ECOLI
43 PsiBlast_CBE 95.6031%-107 - C7 -3LCH - NANA_ECOLI -
52 PsiBlast_CBE 95.4631%-106 - C7 -1HL2 3.3 NANA_ECOLI
1 PsiBlast_PDB 95.4531%-107 - C7 -3LCG - NANA_ECOLI -
9 PsiBlast_PDB 95.4331%-106 - C7 -3LCH - NANA_ECOLI -
34 PsiBlast_CBE 95.4031%-108 - C7 -3LBM - NANA_ECOLI -
7 PsiBlast_PDB 95.3331%-108 - C7 -3LBM - NANA_ECOLI -
45 PsiBlast_CBE 95.2931%-108 - C7 -1FDZ 2.9 NANA_ECOLI
15 PsiBlast_PDB 94.9031%-108 - C7 -3LCW 3.3 NANA_ECOLI
49 PsiBlast_CBE 94.7731%-105 - C7 -1FDY 3.0 NANA_ECOLI
17 PsiBlast_PDB 94.0830%-109 - C7 -4UUI 3.4 ?
46 PsiBlast_CBE 93.3531%-105 - C7 -1FDZ 3.2 NANA_ECOLI
14 PsiBlast_PDB 93.0831%-105 - C7 -4BWL 3.5 NANA_ECOLI