@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0043: (2015-11-27 )
MKTPIISIIMGSKSDWGTMQKTAEVLDNFGIAYEKKVVSAHRAPDLMFKHAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKTRALSGLDSLYSIVQMPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSNELI

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

C2R_I_9(2NSL)
PURE_ECOLI
[Raw transfer]




NIA_A_2(2NSH)
PURE_ECOLI
[Raw transfer]




C2R_I_9(2NSJ)
PURE_ECOLI
[Raw transfer]




AIR_A_5(3RGG)
?
[Raw transfer]




AIR_B_6(3RGG)
?
[Raw transfer]




AIR_C_7(3RGG)
?
[Raw transfer]




AIR_I_9(2FWJ)
?
[Raw transfer]




CIT_B_3(2FW6)
?
[Raw transfer]




CIT_M_13(2FWP)
?
[Raw transfer]




AIR_A_3(2FWI)
?
[Raw transfer]




CIT_A_3(1U11)
?
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




CIT_A_3(1U11)
?
[Raw transfer]




GOL_B_9(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_D_23(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_C_21(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_D_26(3LP6)
PURE_MYCTU
[Raw transfer]




CIT_B_4(1U11)
?
[Raw transfer]




ACY_I_9(2FW1)
?
[Raw transfer]




ACY_M_13(2FW1)
?
[Raw transfer]




79 HHSearch 98.0263%-129 - C4 -3OOW - ? -
21 PsiBlast_CBE 96.7063%-129 - C4 -4AY4 - ? -
25 PsiBlast_CBE 96.4263%-130 - C4 -4AY3 - ? -
3 PsiBlast_PDB 96.3063%-130 - C4 -4AY3 - ? -
23 PsiBlast_CBE 96.1363%-130 - C4 -4AY4 - ? -
26 PsiBlast_CBE 95.9563%-131 - C4 -4AY3 - ? -
2 PsiBlast_PDB 95.5663%-131 - C4 -4B4K - ? -
5 PsiBlast_PDB 95.4261%-129 - C4 -3OOW - ? -
1 PsiBlast_PDB 94.7363%-131 - C4 -1XMP - ? -
24 PsiBlast_CBE 94.7063%-127 - C4 -4AY3 - ? -
22 PsiBlast_CBE 94.5263%-128 - C4 -4AY4 - ? -
4 PsiBlast_PDB 93.8763%-127 - C4 -4AY4 - ? -
6 PsiBlast_PDB 93.8661%-126 - C4 -3OPQ - ? -
8 PsiBlast_PDB 93.5860%-130 - C4 -4GRD - ? -
81 HHSearch 92.6858%-126 - C4 -3ORS - ? -
31 PsiBlast_CBE 92.4959%-129 - C4 -3ORS - ? -
29 PsiBlast_CBE 92.3859%-128 - C4 -3ORS - ? -
62 Fugue 92.3756%-133 - C4 -1O4V - PURE_THEMA -
9 PsiBlast_PDB 92.0659%-128 - C4 -3ORS - ? -
28 PsiBlast_CBE 91.8259%-131 - C4 -3ORS - ? -
34 PsiBlast_CBE 91.4052%-132 - C4 -3LP6 3.4 PURE_MYCTU
35 PsiBlast_CBE 90.7052%-132 - C4 -3LP6 3.6 PURE_MYCTU
36 PsiBlast_CBE 89.7552%-131 - C4 -3LP6 3.6 PURE_MYCTU
10 PsiBlast_PDB 89.6052%-130 - C4 -3LP6 3.4 PURE_MYCTU
78 HHSearch 89.3053%-127 - C4 -3LP6 3.4 PURE_MYCTU
74 HHSearch 88.9453%-128 * C4 *1U11 3.8 ?
49 PsiBlast_CBE 77.8334%-124 - C4 -3RGG 3.8 ?
39 PsiBlast_CBE 76.9460%-114 - C4 -2FWP 4.2 ?
51 PsiBlast_CBE 76.7734%-121 - C4 -3RGG 4.2 ?
50 PsiBlast_CBE 76.7034%-126 - C4 -3RGG 3.8 ?
13 PsiBlast_PDB 76.5561%-117 - C4 -2FWJ 4.7 ?
37 PsiBlast_CBE 76.0661%-117 - C4 -1U11 3.7 ?
38 PsiBlast_CBE 76.0261%-115 - C4 -2FW1 3.3 ?
17 PsiBlast_PDB 75.4560%-116 - C4 -2FWI 3.8 ?
41 PsiBlast_CBE 75.3460%-130 - C4 -2NSL 6.1 PURE_ECOLI
11 PsiBlast_PDB 75.3361%-117 - C4 -1U11 3.8 ?
42 PsiBlast_CBE 75.2260%-128 - C4 -2NSJ 5.9 PURE_ECOLI
12 PsiBlast_PDB 75.0261%-116 - C4 -2FW1 3.6 ?
43 PsiBlast_CBE 74.9360%-125 - C4 -2NSH 5.7 PURE_ECOLI
40 PsiBlast_CBE 73.9660%-113 - C4 -2FW6 3.7 ?