@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0049: (2015-11-27 )
MTRFLDSDAMGDEELVERTLRPQYLREYIGQDKVKDQLKIFIEAAKLRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAIEKSGDLVAILNDLEPGDVLFIDEIHRMPMAVEEVLYSAMEDFYIDIMIGAGETSRSVHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEYYEENDLTEIIERTADIFEMKITYEAASELARRSRGTPRIANRLLKRVRDYAQIMGDGLIDDNITDKALTMLDVDHEGLDYVDQKILRTMIEMYNGGPVGLGTLSVNIAEERDTVEDMYEPYLIQKGFIMRTRTGRVATDKAYEHLGYQRFDK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_2(1IN8)
RUVB_THEMA
[Raw transfer]




ADP_A_5(1IN4)
RUVB_THEMA
[Raw transfer]




ADP_A_4(1IN7)
RUVB_THEMA
[Raw transfer]




ADP_A_2(1IN5)
RUVB_THEMA
[Raw transfer]




ADP_A_4(1IN6)
RUVB_THEMA
[Raw transfer]




ADP_A_5(1IN4)
RUVB_THEMA
[Raw transfer]




ATP_A_5(1J7K)
RUVB_THEMA
[Raw transfer]




ADP_A_3(3PFI)
?
[Raw transfer]




ADP_A_3(3PFI)
?
[Raw transfer]




ANP_C_3(1IXS)
RUVB_THET8
[Raw transfer]




ANP_M_13(1IXR)
RUVB_THET8
[Raw transfer]




ADE_B_6(1HQC)
RUVB_THET8
[Raw transfer]




ADE_A_5(1HQC)
RUVB_THET8
[Raw transfer]




ADE_A_5(1HQC)
RUVB_THET8
[Raw transfer]




ADE_A_5(1HQC)
RUVB_THET8
[Raw transfer]




4 PsiBlast_PDB 90.8955%-100 - C3 -1IN8 8.7 RUVB_THEMA
3 PsiBlast_PDB 90.2655% -99 - C3 -1IN6 8.1 RUVB_THEMA
114 HHSearch 89.8354% -98 * C3 *1IN4 8.3 RUVB_THEMA
5 PsiBlast_PDB 89.8355%-101 - C3 -1IN7 8.5 RUVB_THEMA
1 PsiBlast_PDB 89.7755% -98 - C3 -1IN4 8.3 RUVB_THEMA
6 PsiBlast_PDB 89.1555% -99 - C3 -1J7K 8.5 RUVB_THEMA
2 PsiBlast_PDB 88.9655% -96 - C3 -1IN5 8.0 RUVB_THEMA
7 PsiBlast_PDB 87.6855%-100 - C3 -1IXS 6.0 RUVB_THET8
21 PsiBlast_CBE 86.9755%-101 - C3 -1HQC 4.2 RUVB_THET8
103 Fugue 85.7954% -97 - C3 -1HQC 3.2 RUVB_THET8
8 PsiBlast_PDB 85.7255% -98 - C3 -1HQC 3.2 RUVB_THET8
113 HHSearch 85.3654% -96 - C3 -1HQC 3.2 RUVB_THET8
10 PsiBlast_PDB 84.6647%-101 - C3 -3PFI 8.0 ?
112 HHSearch 84.2847% -97 - C3 -3PFI 8.0 ?
9 PsiBlast_PDB 80.0955% -93 - C3 -1IXR 5.0 RUVB_THET8
125 HHSearch 56.2120% -82 - C3 -2V1U - CDC61_AERPE -
116 HHSearch 52.8421% -82 - C3 -1NJG - DPO3X_ECOLI -
119 HHSearch 50.6322% -87 - C3 -2CHQ - RFCS_ARCFU -
130 HHSearch 50.5821% -80 - C3 -1IQP - RFCS_PYRFU -
127 HHSearch 50.4818% -85 - C3 -3D8B - FIGL1_HUMAN -