@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0082: (2015-11-28 )
MARIAGVDIPNDKRVVISLTYVYGIGLSTSKKILAAAGISEDIRVKDLTPDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKNNARTRKGKAVAIAGKKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_U_21(4JI4)
RS13_THET8
[Raw transfer]

-

CHAIN_U_21(4DR6)
RS13_THET8
[Raw transfer]

-

CHAIN_U_21(4DR7)
RS13_THET8
[Raw transfer]

-

11 PsiBlast_PDB 95.2959% -79 - C6 -1IBK - RS13_THET8 -
63 PsiBlast_CBE 95.1959% -85 - C6 -2UXD - RS13_THET8 -
72 PsiBlast_CBE 95.0259% -78 - C6 -1XMO - RS13_THET8 -
118 Fugue 94.9960% -74 - C6 -1FJG - RS13_THET8 -
6 PsiBlast_PDB 94.9959% -74 - C6 -1FJG - RS13_THET8 -
71 PsiBlast_CBE 94.9759% -84 - C6 -1XMQ - RS13_THET8 -
97 HHSearch 94.7260% -79 - C6 -2VQE - RS13_THET8 -
9 PsiBlast_PDB 94.6559% -80 - C6 -1HNX - RS13_THET8 -
17 PsiBlast_PDB 94.2959% -81 - C6 -1J5E - RS13_THET8 -
10 PsiBlast_PDB 94.2259% -76 - C6 -1HNZ - RS13_THET8 -
58 PsiBlast_CBE 94.1659% -74 - C6 -3T1Y - RS13_THET8 -
59 PsiBlast_CBE 94.0159% -80 - C6 -3T1H - RS13_THET8 -
7 PsiBlast_PDB 93.8859% -77 - C6 -1HR0 - RS13_THET8 -
8 PsiBlast_PDB 93.4859% -76 - C6 -1HNW - RS13_THET8 -
29 PsiBlast_CBE 90.3559% -78 - C6 -4LF5 - RS13_THET8 -
48 PsiBlast_CBE 89.6359% -74 - C6 -4DR6 3.3 RS13_THET8
19 PsiBlast_PDB 89.3659% -84 - C6 -1N32 - RS13_THET8 -
45 PsiBlast_CBE 89.3359% -80 - C6 -4DUZ - RS13_THET8 -
34 PsiBlast_CBE 88.5459% -68 - C6 -4JI4 3.5 RS13_THET8
47 PsiBlast_CBE 88.5259% -72 - C6 -4DR7 3.4 RS13_THET8