@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0091: (2015-11-28 )
MSKVRLYIARHGKTMFNTIGRAQGWSDTPLTTFGELGIKELGLGLKASNISFKEAFSSDSGRTLQTMEIILREVQQENIPYTRDKRIREWCFGSLDGGYDGDLFNGVLPRVSNGDMSHLTHEEIANLICQVDTAGWAEPWAILSNRILSGFTAIAKKIEDIGGGNAIVVSHGMTIATFLWLIDHSTPRSLGIDNGSVSVVDFEDGTFSIQSIGDMSYREKGREILEKTLQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EPE_A_3(3R7A)
?
[Raw transfer]




EPE_A_3(3R7A)
?
[Raw transfer]




EDO_A_4(1H2E)
?
[Raw transfer]




GOL_A_7(1EBB)
?
[Raw transfer]




1 PsiBlast_PDB 96.9836% -83 - C4 -3R7A 2.6 ?
75 HHSearch 92.7534% -82 - C4 -3R7A 2.6 ?
4 PsiBlast_PDB 83.8828% -74 - C4 -1EBB 2.6 ?
2 PsiBlast_PDB 81.0127% -70 - C4 -1H2E 3.1 ?
5 PsiBlast_PDB 80.9726% -70 - C3 -4EMB - GPMA_BORBU -
3 PsiBlast_PDB 80.8827% -74 - C4 -1H2F - ? -
80 HHSearch 75.8025% -61 - C4 -3DCY - TIGAR_HUMAN -
74 HHSearch 75.5726% -65 - C4 -1H2E - ? -
73 HHSearch 73.8224% -66 - C4 -3E9C - TIGRB_DANRE -
85 HHSearch 70.8021% -77 - C4 -3HJG - ? -
88 HHSearch 69.4020% -54 - C4 -1RII - GPMA_MYCTU -
84 HHSearch 69.1919% -56 - C4 -3KKK - ? -
90 HHSearch 68.2421% -59 - C4 -3D8H - ? -
77 HHSearch 67.2720% -60 - C4 -2A6P - ? -
82 HHSearch 67.2320% -53 - C4 -1QHF - PMG1_YEAST -
97 HHSearch 67.1326% -75 - C4 -1V37 - ? -
76 HHSearch 65.7519% -51 * C4 *3GP3 - GPMA_BURP1 -
96 HHSearch 65.4119% -67 - C4 -3C7T - ? -
81 HHSearch 64.7121% -65 - C4 -1FZT - PMGY_SCHPO -
89 HHSearch 64.6518% -55 - C4 -3D4I - UBS3A_MOUSE -