@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0092: (2015-11-28 )
MKKNKIIRFSLVGVLLAILCFSLFALLKPNSQQSSSQKLRNEDIKKISSQKRNKKLQLPAVSSKDWNLILVNRDHKHEELSPDVVPVENIYLDKRITKQATQFLEAARAIDSREHLISGYRSVAYQEKLFNSYVTQEMTSNPNLTRGQAEKLVKTYSQPAGASEHQTGLAMDMSTVDSLNESDPRVVSQLKKIAPQYGFVLRFPDGKTAETGVGYEDWHYRYVGVESAKYMAKHHLTLEEYITLLKENNQ

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DAL_A_8(4OX5)
?
[Raw transfer]




2 PsiBlast_PDB 90.1233% -34 - C1 -4MPH - ? -
13 PsiBlast_PDB 89.8130% -22 - C1 -4OX3 - YODJ_BACSU -
18 PsiBlast_CBE 89.2036% -49 - C1 -4OXD - ? -
19 PsiBlast_CBE 89.0136% -43 - C1 -4D0Y - ? -
1 PsiBlast_PDB 88.9333% -37 - C1 -4JID - ? -
14 PsiBlast_CBE 88.7633% -39 - C1 -4MPH - ? -
4 PsiBlast_PDB 88.2636% -43 - C1 -4OXD - ? -
5 PsiBlast_PDB 87.9136% -38 - C1 -4D0Y - ? -
37 Fugue 87.8737% -15 * C1 *4D0Y - ? -
7 PsiBlast_PDB 87.8729% -46 - C1 -4MUQ - ? -
20 PsiBlast_CBE 87.7136% -34 - C1 -4NT9 - ? -
23 PsiBlast_CBE 87.3631% -45 - C1 -4MUT - ? -
15 PsiBlast_CBE 87.3036% -49 - C1 -4OXD - ? -
6 PsiBlast_PDB 87.1136% -32 - C1 -4NT9 - ? -
17 PsiBlast_CBE 87.0636% -46 - C1 -4OXD - ? -
21 PsiBlast_CBE 86.5236% -32 - C1 -4NT9 - ? -
24 PsiBlast_CBE 86.3531% -48 - C1 -4MUS - ? -
11 PsiBlast_PDB 85.6731% -49 - C1 -4MUS - ? -
16 PsiBlast_CBE 85.5536% -47 - C1 -4OXD - ? -
12 PsiBlast_PDB 85.4631% -35 - C1 -4OAK - ? -
3 PsiBlast_PDB 73.0536% 3 - C1 -4OX5 3.3 ?