@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0122: (2015-11-28 )
MTKLRRFRFPLRFYFTLMFVLTMLFSVLASLLLVAAIVFTFFQGVLTTHVLQVSALAVVFLSLVIASISMWYGSYHLTKPILDISRIVSNVADGDFEGHIYRNSNRRKSYEYYNELDELSESINQMIVSLSHMDHMRKDFITNVSHELKTPIAAVANIVELLQDPELDEETQSELLGLVKTESLRLTRLCDTMLQMSRVDNQETIGELSSVRVDEQIRQAMISLTERWQAKRINFQLDSKPYTVYSNSDLLMQVWINLLDNAIKYSDDIVDLRVRMEETNNHYLRVIISDKGRGISQYDVQHIFDKFYQADQSHNQQGNGLGLAIVKRIIVLCKGRISVSSQFEIGTEFCVELPLS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AN2_B_4(4U7O)
?
[Raw transfer]




ATP_A_4(3SL2)

[Raw transfer]




ADP_A_3(4JAS)
?
[Raw transfer]




ADP_A_8(4JAV)
?
[Raw transfer]




ADP_A_7(3DGE)
?
[Raw transfer]




ADP_B_13(4JAV)
?
[Raw transfer]




AN2_A_3(4U7O)
?
[Raw transfer]




ADP_B_8(3DGE)
?
[Raw transfer]




ADP_A_2(2C2A)
?
[Raw transfer]




ADP_A_2(2C2A)
?
[Raw transfer]




ADP_A_2(4JAU)
?
[Raw transfer]




8 PsiBlast_PDB 91.3532%-115 - C4 -4JAU 6.8 ?
22 PsiBlast_CBE 90.4232%-101 - C4 -4JAV 8.0 ?
6 PsiBlast_PDB 90.1532%-108 - C4 -4JAV 8.5 ?
7 PsiBlast_PDB 89.0332%-104 - C4 -4JAS 9.1 ?
23 PsiBlast_CBE 88.7932% -94 - C4 -3DGE 8.0 ?
5 PsiBlast_PDB 88.5532% -97 - C4 -3DGE 6.7 ?
4 PsiBlast_PDB 88.2932%-110 - C4 -2C2A 7.0 ?
38 HHSearch 86.6431%-108 - C4 -2C2A 7.0 ?
2 PsiBlast_PDB 83.6734% -92 - C4 -4U7O 9.1 ?
21 PsiBlast_CBE 80.6334% -94 - C4 -4U7O 10.2 ?
1 PsiBlast_PDB 79.3734% -93 - C4 -4U7N - ? -
9 PsiBlast_PDB 74.0525% -81 - C4 -4Q20 - DIVL_CAUCR -
31 Fugue 69.9415% -91 - C4 -1GKZ - BCKD_RAT -
14 PsiBlast_PDB 69.8623% -66 - C4 -4BIV - CPXA_ECOLI -
3 PsiBlast_PDB 69.0333% -86 - C4 -4I5S - ? -
28 Fugue 68.8725% -81 - C4 -4I5S - ? -
40 HHSearch 68.3225%-102 - C4 -3A0R - ? -
43 HHSearch 66.2327%-111 * C4 *3A0Y - ? -
47 HHSearch 65.9525%-112 - C4 -1ID0 - -
20 PsiBlast_PDB 65.9421% -94 - C4 -3D36 - ? -