@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0126: (2015-11-28 )
MTRKIGIIGMGHVGSTVAHALIAQGIGDDYVFIDTNIDKVNADMIDFQDALANATYHANIVLNDYDALSDADVVISALGDISLQNNKEANRFAELPFTSKEVYDVSQKLKSSGFRGILIVVTNPVDAITQLYQEYTQFPKSRVIGTGTLLDTARMKRVLGQRLQVDPRSIGGYNLGEHGNSQFVAWSQVTVKGQPAISLLKAEELEQIKEASLKGGHTVFFGKKYTSYGIATAAVRIVLAVLNDSHELLPVSTFYESEGVYLGYPAIIGRVGIVERISLSLSPKEEQQLTDSAAFIRNYLKHINL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_D_12(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_B_10(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_C_11(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_A_9(1HYH)
DHL2_WEICO
[Raw transfer]




NAD_A_9(1HYH)
DHL2_WEICO
[Raw transfer]




22 PsiBlast_CBE 98.1857%-117 - C3 -1HYH 6.3 DHL2_WEICO
21 PsiBlast_CBE 95.5757%-115 - C3 -1HYH 7.2 DHL2_WEICO
23 PsiBlast_CBE 92.0557%-109 - C3 -1HYH 10.0 DHL2_WEICO
1 PsiBlast_PDB 90.5557%-110 - C3 -1HYH 10.5 DHL2_WEICO
113 HHSearch 89.4757%-108 - C3 -1HYH 10.6 DHL2_WEICO
29 PsiBlast_CBE 83.9134%-105 - C3 -3WSV - ? -
30 PsiBlast_CBE 83.3434%-107 - C3 -3PQF - LDH_BACSU -
2 PsiBlast_PDB 83.3434%-103 - C3 -3WSV - ? -
33 PsiBlast_CBE 83.0834%-106 - C3 -3PQD - LDH_BACSU -
24 PsiBlast_CBE 82.7834%-105 - C3 -3WSW - ? -
25 PsiBlast_CBE 82.6734%-107 - C3 -3WSW - ? -
49 PsiBlast_CBE 82.6234%-106 - C3 -1LDN - LDH_GEOSE -
27 PsiBlast_CBE 82.5234%-105 - C3 -3WSV - ? -
11 PsiBlast_PDB 82.4334%-112 - C3 -3VKU - LDH_LACCA -
6 PsiBlast_PDB 82.0034%-106 - C3 -3PQD - LDH_BACSU -
36 PsiBlast_CBE 81.6734%-110 - C3 -3PQD - LDH_BACSU -
37 PsiBlast_CBE 81.5334%-107 - C3 -3PQD - LDH_BACSU -
46 PsiBlast_CBE 81.4634%-103 - C3 -1LDN - LDH_GEOSE -
3 PsiBlast_PDB 81.3434%-108 - C3 -3WSW - ? -
26 PsiBlast_CBE 81.2434%-103 - C3 -3WSW - ? -