@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0171: (2015-11-29 )
MKIGIIGVGKMASAIIQGLKQTQHDIVISGSCLERSKEIAERLDVTYAESHQSLINQADIIMLGIKPQLFEKVLLPLDITKPIISMAAGISLARLSQLTRSDLPLIRIMPNINAQILQSCTAICYNNHVSDELRQLTKEITDSFGSSFDIAETNFDTFTALAGSSPAYIYLFIEALAKAGVKYGFPKEQALSIVGQTVLASSQNLLQGQNSTSDLIDNICSPGGTTIAGLLDLEKNGLTHSVISAIDATIEKAKKL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_11(2AHR)
?
[Raw transfer]




NAP_A_11(2AHR)
?
[Raw transfer]




PRO_B_13(2AMF)
?
[Raw transfer]




PRO_E_15(2AMF)
?
[Raw transfer]




PRO_C_12(2AMF)
?
[Raw transfer]




PRO_D_11(2AMF)
?
[Raw transfer]




PRO_A_14(2AMF)
?
[Raw transfer]




35 HHSearch 92.9770%-131 - C1 -2AHR 9.9 ?
2 PsiBlast_PDB 92.0668%-131 - C1 -2AHR 9.9 ?
21 PsiBlast_CBE 91.9769%-129 - C1 -2AMF 2.6 ?
23 PsiBlast_CBE 91.9569%-129 - C1 -2AMF 3.8 ?
24 PsiBlast_CBE 91.8669%-128 - C1 -2AMF 2.5 ?
22 PsiBlast_CBE 91.7269%-133 - C1 -2AMF 3.7 ?
1 PsiBlast_PDB 91.6369%-131 - C1 -2AMF 3.8 ?
37 HHSearch 73.4030%-122 - C1 -3TRI - ? -
9 PsiBlast_PDB 72.1329%-128 - C1 -3TRI - ? -
33 HHSearch 71.6924%-119 - C1 -1YQG - ? -
34 HHSearch 71.1432%-119 - C1 -2RCY - ? -
36 HHSearch 70.5327%-111 - C1 -2IZZ - P5CR1_HUMAN -
7 PsiBlast_PDB 68.3027%-109 - C1 -2GER - P5CR1_HUMAN -
5 PsiBlast_PDB 68.3027%-107 - C1 -2GRA - P5CR1_HUMAN -
4 PsiBlast_PDB 68.2627%-109 - C1 -2GR9 - P5CR1_HUMAN -
6 PsiBlast_PDB 68.0527%-108 - C1 -2IZZ - P5CR1_HUMAN -
56 Fugue 66.5128%-105 * C1 *3TRI - ? -
10 PsiBlast_PDB 59.9722%-106 - C1 -1YQG - ? -
11 PsiBlast_PDB 59.9122%-108 - C1 -2AG8 - ? -
3 PsiBlast_PDB 57.5433%-103 - C1 -2RCY - ? -