@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0306: (2015-11-30 )
MEISLLTDIGQRRSNNQDFINQFENKAGVPLIILADGMGGHRAGNIASEMTVTDLGSDWAETDFSELSEIRDWMLVSIETENRKIYELGQSDDYKGMGTTIEAVAIVGDNIIFAHVGDSRIGIVRQGEYHLLTSDHSLVNELVKAGQLTEEEAASHPQKNIITQSIGQANPVEPDLGVHLLEEGDYLVVNSDGLTNMLSNADIATVLTQEKTLDDKNQDLITLANHRGGLDNITVALVYVESEAV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_4(3RNR)
?
[Raw transfer]




GOL_A_6(3RNR)
?
[Raw transfer]




23 PsiBlast_CBE 99.30100% -96 - C1 -2PK0 - ? -
22 PsiBlast_CBE 98.20100% -95 - C1 -2PK0 - ? -
25 HHSearch 97.05100% -95 - C1 -2PK0 - ? -
1 PsiBlast_PDB 97.05100% -95 - C1 -2PK0 - ? -
21 PsiBlast_CBE 96.94100% -93 - C1 -2PK0 - ? -
27 HHSearch 60.4034% -71 - C1 -1TXO - PSTP_MYCTU -
11 PsiBlast_PDB 59.4334% -66 - C1 -1TXO - PSTP_MYCTU -
2 PsiBlast_PDB 56.6334% -73 - C1 -2J82 - ? -
6 PsiBlast_PDB 56.4533% -69 - C1 -2Y09 - ? -
5 PsiBlast_PDB 56.2233% -72 - C1 -2XZV - ? -
26 HHSearch 56.1732% -77 - C1 -2J82 - ? -
29 HHSearch 55.8532% -59 - C1 -2JFR - ? -
3 PsiBlast_PDB 49.9034% -67 - C1 -2J86 - ? -
53 Fugue 48.9919% -63 - C1 -4JND - FEM2_CAEEL -
4 PsiBlast_PDB 48.8734% -64 - C1 -2CM1 - PSTP_MYCTU -
34 HHSearch 47.6021% -65 - C1 -3KDJ - P2C56_ARATH -
24 PsiBlast_CBE 47.1334% -66 - C1 -2J86 - ? -
9 PsiBlast_PDB 46.9432% -43 - C1 -2JFT - ? -
8 PsiBlast_PDB 46.1732% -45 - C1 -2JFS - ? -
7 PsiBlast_PDB 45.3532% -44 - C1 -2JFR - ? -