@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0333: (2015-11-30 )
MKTRITELLNIKYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSMTDKPFGVNIMLLSPFVDDIVDLVIEEGVKVVTTGAGNPGKYMERFHEAGITVIPVVPSVALAKRMEKLGADAIITEGMEAGGHIGKLTTMTLVRQVVDAVTIPVIAAGGIADGRGAAAGFMLGADAVQVGTRFVVAKESNAHPNYKAKILKAKDIDTAVSAQVVGHPVRALKNKLVTTYSQAEKDYLAGRISINEIEELGAGALRNAVVDGDVINGSVMAGQIAGLIKSEETCQEILEDIYSGARQVILSEASRWSDL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_9(2Z6J)
?
[Raw transfer]




FMN_A_7(2Z6J)
?
[Raw transfer]




FMN_A_9(2Z6I)
?
[Raw transfer]




FMN_A_9(2Z6I)
?
[Raw transfer]




TUI_B_10(2Z6J)
?
[Raw transfer]




FMN_A_3(4IQL)
?
[Raw transfer]




TUI_A_8(2Z6J)
?
[Raw transfer]




FMN_B_10(4IQL)
?
[Raw transfer]




21 PsiBlast_CBE 91.6980%-104 - C3 -2Z6J 8.8 ?
56 HHSearch 91.4980%-103 * C3 *2Z6I 9.3 ?
1 PsiBlast_PDB 91.0480%-105 - C3 -2Z6J 8.8 ?
2 PsiBlast_PDB 89.6478%-103 - C3 -2Z6I 9.3 ?
3 PsiBlast_PDB 78.4250% -99 - C3 -3BO9 - ? -
57 HHSearch 77.8551% -99 - C3 -3BO9 - ? -
4 PsiBlast_PDB 76.6144% -95 - C3 -4IQL 9.6 ?
22 PsiBlast_CBE 75.2344% -94 - C3 -4IQL 9.4 ?
6 PsiBlast_PDB 70.4935% -85 - C3 -2GJN - 2NPD_PSEAE -
5 PsiBlast_PDB 69.9035% -87 - C3 -2GJL - 2NPD_PSEAE -
58 HHSearch 69.6435% -89 - C3 -2GJL - 2NPD_PSEAE -
79 Fugue 68.6034% -88 - C3 -2GJL - 2NPD_PSEAE -
7 PsiBlast_PDB 57.8332% -89 - C3 -4Q4K - ? -
8 PsiBlast_PDB 57.3232% -93 - C3 -4QIS - ? -
25 PsiBlast_CBE 57.3032% -91 - C3 -4QIT - ? -
10 PsiBlast_PDB 56.8032% -91 - C3 -4QIU - ? -
26 PsiBlast_CBE 56.7332% -93 - C3 -4QIU - ? -
23 PsiBlast_CBE 56.2432% -88 - C3 -4Q4K - ? -
24 PsiBlast_CBE 55.9632% -91 - C3 -4QIS - ? -
9 PsiBlast_PDB 55.9032% -88 - C3 -4QIT - ? -