@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0338: (2015-11-30 )
MIDIKEIREALPHRYPMLLVDRVLEVSEDEIVAIKNVSINEPFFNGHFPEYPVMPGVLIMEALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVMTAKFVKRRGTIAVVEAIAEVDGKLAASGTLTFAIGN

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BC_B_11(3DP0)
?
[Raw transfer]




2RB_B_10(3DP1)
?
[Raw transfer]




3BE_B_14(3DOZ)
?
[Raw transfer]




SCB_A_15(2GLM)
FABZ_HELPY
[Raw transfer]




EMO_A_10(3ED0)
?
[Raw transfer]




DAC_A_3(1MKA)
FABA_ECOLI
[Raw transfer]




177 HHSearch 96.5353%-138 - C1 -1U1Z - FABZ_PSEAE -
114 PsiBlast_CBE 92.6447%-149 - C1 -1Z6B - ? -
9 PsiBlast_PDB 92.2950%-139 - C1 -4H4G - FABZ_BURTA -
95 PsiBlast_CBE 92.2547%-145 - C1 -3AZ8 - ? -
111 PsiBlast_CBE 91.8747%-147 - C1 -1Z6B - ? -
46 PsiBlast_CBE 91.7647%-136 - C1 -3AZA - ? -
112 PsiBlast_CBE 91.6447%-151 - C1 -1Z6B - ? -
71 PsiBlast_CBE 91.4047%-140 - C1 -3AZ9 - ? -
62 PsiBlast_CBE 91.2847%-135 - C1 -3AZA - ? -
85 PsiBlast_CBE 91.2447%-141 - C1 -3AZ9 - ? -
4 PsiBlast_PDB 91.2147%-136 - C1 -3AZ9 - ? -
41 PsiBlast_CBE 91.0947%-138 - C1 -3AZB - ? -
43 PsiBlast_CBE 90.9647%-145 - C1 -3AZB - ? -
2 PsiBlast_PDB 90.8947%-148 - C1 -1Z6B - ? -
3 PsiBlast_PDB 90.8047%-142 - C1 -3AZ8 - ? -
72 PsiBlast_CBE 90.7847%-146 - C1 -3AZ9 - ? -
5 PsiBlast_PDB 90.7647%-142 - C1 -3AZA - ? -
113 PsiBlast_CBE 90.7147%-150 - C1 -1Z6B - ? -
110 PsiBlast_CBE 90.6747%-146 - C1 -3AZ8 - ? -
47 PsiBlast_CBE 90.5447%-142 - C1 -3AZA - ? -
11 PsiBlast_PDB 85.3546%-128 - C1 -2GLM 5.3 FABZ_HELPY
19 PsiBlast_PDB 84.8846%-122 - C1 -3DP0 4.8 ?
20 PsiBlast_PDB 84.7746%-125 - C1 -3DP1 3.9 ?
18 PsiBlast_PDB 84.6246%-127 - C1 -3DOZ 4.8 ?
136 PsiBlast_CBE 84.2646%-124 - C1 -3ED0 3.5 ?