@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0429: (2015-11-30 )
MTQKLLLVDDEFEIIDINRRYLEQAGYEVSVAADGIEALKEVDENRFDLIISDIMMPKMDGYDFISEVLVREPNQPFLFITAKVSEPDKIYSLSMGADDFISKPFSPRELVLRVKNILRRIYGNHQQSEVLTIGDLVIDQKQRLVMVDCNTISLTNKSFDLLWILANHLNRVFSKTELYERVWGEEFLDDTNTLNVHIHALRNDLAKFSTDNTPTIKTVWGLGYKLEE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_C_3(1NXW)
?
[Raw transfer]




PHS_C_3(1NXP)
?
[Raw transfer]




GOL_A_4(2GWR)
MTRA_MYCTU
[Raw transfer]




90 HHSearch 93.8738%-106 - C5 -1YS7 - PRRA_MYCTU -
3 PsiBlast_PDB 87.1639%-102 - C5 -1YS7 - PRRA_MYCTU -
6 PsiBlast_PDB 86.7937%-101 - C4 -2GWR - MTRA_MYCTU -
89 HHSearch 85.5138% -94 - C4 -2GWR 2.1 MTRA_MYCTU
2 PsiBlast_PDB 84.6039% -99 - C5 -1YS6 - PRRA_MYCTU -
24 PsiBlast_CBE 82.4131%-110 - C4 -4KNY - KDPE_ECOLI -
21 PsiBlast_CBE 80.7339% -85 - C5 -1YS7 - PRRA_MYCTU -
22 PsiBlast_CBE 80.4539% -83 - C5 -1YS6 - PRRA_MYCTU -
11 PsiBlast_PDB 80.0531%-100 - C4 -4KNY - KDPE_ECOLI -
1 PsiBlast_PDB 78.9838% -79 - C5 -2OQR - REGX3_MYCTU -
10 PsiBlast_PDB 78.8131%-101 - C4 -4KFC - KDPE_ECOLI -
93 HHSearch 78.6838% -86 - C5 -2OQR - REGX3_MYCTU -
95 HHSearch 77.7832% -99 - C4 -1KGS - ? -
7 PsiBlast_PDB 76.6532%-102 - C4 -1KGS - ? -
91 HHSearch 66.5523% -99 - C4 -2HQR - ? -
5 PsiBlast_PDB 66.0146% -91 - C4 -1MVO - PHOP_BACSU -
8 PsiBlast_PDB 65.9849% -95 - C4 -2ZWM - YYCF_BACSU -
23 PsiBlast_CBE 65.8749% -96 - C4 -2ZWM - YYCF_BACSU -
9 PsiBlast_PDB 64.4749% -88 - C4 -3F6P - YYCF_BACSU -
20 PsiBlast_PDB 64.2744% -91 - C4 -2A9Q - ? -
16 PsiBlast_PDB 61.8244% -86 - C4 -1NXW 3.9 ?
13 PsiBlast_PDB 58.8744% -85 - C4 -1NXP 2.9 ?