@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0454: (2015-12-01 )
MDSTVKVVYFSSKSNNTHRFVQKLAWSNQRIPSDGSNILVTEDYILIVPTYAGGGDDTKGAVPKQVVQFLNVRQNREHCQGVISSGNTNFGDTYAIAGPIIARKLNVPLLHQFELLGTQEDVTRVKELLCQFTRKDK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_C_8(3N3B)
NRDI_ECOLI
[Raw transfer]




FMN_C_7(3N39)
NRDI_ECOLI
[Raw transfer]




FMN_D_10(3N39)
NRDI_ECOLI
[Raw transfer]




FMN_D_12(3N3B)
NRDI_ECOLI
[Raw transfer]




FMN_D_10(3N3A)
NRDI_ECOLI
[Raw transfer]




FMN_C_7(3N3A)
NRDI_ECOLI
[Raw transfer]




FMN_C_7(3N3A)
NRDI_ECOLI
[Raw transfer]




21 PsiBlast_CBE 98.7851%-143 - C3 -3N3B 9.9 NRDI_ECOLI
3 PsiBlast_PDB 96.9951%-135 - C3 -3N3B 10.1 NRDI_ECOLI
22 PsiBlast_CBE 95.3951%-139 - C3 -3N3A 10.3 NRDI_ECOLI
1 PsiBlast_PDB 95.1751%-139 - C3 -3N39 10.2 NRDI_ECOLI
23 PsiBlast_CBE 94.2051%-141 - C3 -3N39 9.8 NRDI_ECOLI
2 PsiBlast_PDB 93.5351%-131 - C3 -3N3A 10.7 NRDI_ECOLI
24 HHSearch 92.5450%-126 - C3 -3N3A 10.7 NRDI_ECOLI
11 PsiBlast_PDB 82.0826%-113 - C3 -4N82 - ? -
8 PsiBlast_PDB 79.2038%-118 - C3 -4BMO - ? -
6 PsiBlast_PDB 78.3738%-123 - C3 -2X2O - ? -
7 PsiBlast_PDB 78.1838%-121 - C3 -2X2P - ? -
9 PsiBlast_PDB 78.1638%-114 - C3 -4BMP - ? -
4 PsiBlast_PDB 77.5138%-121 - C3 -2XOD - ? -
26 HHSearch 75.6834%-132 - C3 -2XOD - ? -
5 PsiBlast_PDB 75.2338%-120 - C3 -2XOE - ? -
25 HHSearch 74.7430%-113 - C3 -1RLJ - NRDI_BACSU -
46 Fugue 74.5328%-104 - C3 -4N82 - ? -
47 Fugue 73.6030%-104 - C3 -1RLJ - NRDI_BACSU -
10 PsiBlast_PDB 70.2233%-106 - C3 -1RLJ - NRDI_BACSU -
29 HHSearch 58.9215% -89 * C3 *2BMV - FLAV_HELPY -